LXL04_009644 | RubberDandelionOmics

Gene overview

LXL04_009644

Reference: OH-1004 Chr: Chr02 Coordinates: 130336519-130338878 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

975 bp · LXL04_009644|LXL04_009644|OH1004|cDNA

ATGAAATCGTTGAAGTTCCCATTTGATCGATCCAACACTCGGAAATTCCGTATAATCAATTGCTCGTTAGTGATTGCGTTGTTTACACTGCTATCTATCTTATTTACAGTCATTGTAAAATGGCAAAAAGAGCTATACCGGGATGTGGAGATAGATACGACTCAGCCTCCATGCGTTTTCAAATGTCAATTATATGACCTCACTGGAGTACCACCCGAAAGGCAAAAAATAGTGACGAAAGGTGGATTACTAAAGGATGA...

CDS

Download CDS FASTA

975 bp · LXL04_009644|LXL04_009644|OH1004|CDS

ATGAAATCGTTGAAGTTCCCATTTGATCGATCCAACACTCGGAAATTCCGTATAATCAATTGCTCGTTAGTGATTGCGTTGTTTACACTGCTATCTATCTTATTTACAGTCATTGTAAAATGGCAAAAAGAGCTATACCGGGATGTGGAGATAGATACGACTCAGCCTCCATGCGTTTTCAAATGTCAATTATATGACCTCACTGGAGTACCACCCGAAAGGCAAAAAATAGTGACGAAAGGTGGATTACTAAAGGATGA...

Protein

Download Protein FASTA

324 aa · LXL04_009644|LXL04_009644|OH1004|PROTEIN

MKSLKFPFDRSNTRKFRIINCSLVIALFTLLSILFTVIVKWQKELYRDVEIDTTQPPCVFKCQLYDLTGVPPERQKIVTKGGLLKDDSNWSKMGVQEGQRLMMMGTTDEIVNAPVKSPVFYGRSSGRRTSSCCGRGHSAGLFNLGNTCYMNSTVQCLHSVPELKSALIEYSQSGRSNDLDQSSHLLTVATRNLFTELDKNVKPVAPMQFSMDAKECCSQILYTLSQALRRLSSRHYPNETCNENIDTVKGLFGVDLVSRY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009644`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009644

Location Chr02:130336519-130338878 (-)

Description Similar to UBP7: Ubiquitin carboxyl-terminal hydrolase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21280`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release
`At1g51710`	Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009644 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016579 protein deubiquitination Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0050920 regulation of chemotaxis Biological Process

GO:0061136 regulation of proteasomal protein catabolic process Biological Process

GO:0071108 protein K48-linked deubiquitination Biological Process

GO:1904293 negative regulation of ERAD pathway Biological Process

GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G51710

ath:AT3G21280

hsa:9097

mmu:59025

ptr:455325

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.528

Rank 1 · LXL04_009644 · OH-1004

Nucleus0.387

Rank 2 · LXL04_009644 · OH-1004

Mitochondrion0.137

Rank 3 · LXL04_009644 · OH-1004

Cell membrane0.082

Rank 4 · LXL04_009644 · OH-1004

Endoplasmic reticulum0.070

Rank 5 · LXL04_009644 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240.30ubiquitin49-107 aa

PF00443.36UCH140-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009644	`PF00240.30`	ubiquitin	49	107	9.3e-07	29.3
LXL04_009644	`PF00443.36`	UCH	140	267	1.4e-16	61.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WC6`	Arabidopsis thaliana	Ubiquitin carboxyl-terminal hydrolase 7	56.098%	Swiss-Prot	moderate database homology
`Q949Y0`	Arabidopsis thaliana	Ubiquitin carboxyl-terminal hydrolase 6	56.557%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card