LXL04_009549 | RubberDandelionOmics

Gene overview

LXL04_009549

Reference: OH-1004 Chr: Chr02 Coordinates: 128779246-128782098 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1590 bp · LXL04_009549|LXL04_009549|OH1004|cDNA

ATGGCCACTCCTCCAAACCCTACTGATGGGAACCCCCAAAATCCAGTTCCAGACGCTGTAAATCCAACGACTAATGCTCAACAAGAAGCCGACAAAGGAGCTACCAAAGAACCATCAATATTTGTCAACACAGAACCAATTCGAGAAGACCAAGTGCAAAATGCTATCAAGTTCCTTTCACATCCGAAGGTCAAGGGATCTCCAGTTATGTACAGACGATCTTTTCTTGAGAGAAAAGGCCTTACAAAAGAAGAGATAGA...

CDS

Download CDS FASTA

1590 bp · LXL04_009549|LXL04_009549|OH1004|CDS

ATGGCCACTCCTCCAAACCCTACTGATGGGAACCCCCAAAATCCAGTTCCAGACGCTGTAAATCCAACGACTAATGCTCAACAAGAAGCCGACAAAGGAGCTACCAAAGAACCATCAATATTTGTCAACACAGAACCAATTCGAGAAGACCAAGTGCAAAATGCTATCAAGTTCCTTTCACATCCGAAGGTCAAGGGATCTCCAGTTATGTACAGACGATCTTTTCTTGAGAGAAAAGGCCTTACAAAAGAAGAGATAGA...

Protein

Download Protein FASTA

529 aa · LXL04_009549|LXL04_009549|OH1004|PROTEIN

MATPPNPTDGNPQNPVPDAVNPTTNAQQEADKGATKEPSIFVNTEPIREDQVQNAIKFLSHPKVKGSPVMYRRSFLERKGLTKEEIDEAFRRVPDESPSVATTQPAVVNQGGQSQTASNIQPQAPIQSLQPVTAPTSKLGTKFHWSHALLAVGVLAISGAGTAVVFKNAVVPRLKSWIKKVVHEDEKEDVGNETDRKPTPAEEAAASAKAAAAAAADVARASQDMLASKTEEKKYFGELLSLLDVQVQEMKSMSNSIRKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009549`
TK1151 ID	TkA03G447280
OH-1004 ID	LXL04_009549
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009549

Location Chr02:128779246-128782098 (-)

Description Similar to PEX14: Peroxisomal membrane protein PEX14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62810`	Component of the PEX13-PEX14 docking complex, a translocon channel that specifically mediates the import of peroxisomal cargo proteins bound to PEX5 receptor.	AtPex14p maintains peroxisomal functions by determining protein targeting to three kinds of plant peroxisomes.2000 · DOI: 10.1093/emboj/19.21.5701 Functional classification of Arabidopsis peroxisome biogenesis factors proposed from analyses of knockdown mutants.2007 · DOI: 10.1093/pcp/pcm053 Molecular components required for the targeting of PEX7 to peroxisomes in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2009.03970.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009549 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006625 protein targeting to peroxisome Biological Process

GO:0007031 peroxisome organization Biological Process

GO:0016558 protein import into peroxisome matrix Biological Process

GO:0016560 protein import into peroxisome matrix, docking Biological Process

GO:0016561 protein import into peroxisome matrix, translocation Biological Process

GO:0016562 protein import into peroxisome matrix, receptor recycling Biological Process

GO:0034453 microtubule anchoring Biological Process

GO:0034614 cellular response to reactive oxygen species Biological Process

GO:0036250 peroxisome transport along microtubule Biological Process

GO:0043335 protein unfolding Biological Process

GO:0044721 protein import into peroxisome matrix, substrate release Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT5G62810

hsa:5195

mmu:56273

rno:64460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.399

Rank 1 · LXL04_009549 · OH-1004

Mitochondrion0.206

Rank 2 · LXL04_009549 · OH-1004

Cytoplasm0.197

Rank 3 · LXL04_009549 · OH-1004

Nucleus0.161

Rank 4 · LXL04_009549 · OH-1004

Endoplasmic reticulum0.099

Rank 5 · LXL04_009549 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04695.19Pex14_N48-92 aa

PF23020.2PEX14-like_2nd142-261 aa

PF17733.8KPWE_dom314-362 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009549	`PF04695.19`	Pex14_N	48	92	2e-13	50.5
LXL04_009549	`PF23020.2`	PEX14-like_2nd	142	261	3.3e-53	179.8
LXL04_009549	`PF17733.8`	KPWE_dom	314	362	1.3e-16	61.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FXT6`	Arabidopsis thaliana	Peroxisomal membrane protein PEX14	52.642%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card