LXL04_009543 | RubberDandelionOmics

Gene overview

LXL04_009543

Reference: OH-1004 Chr: Chr02 Coordinates: 128694177-128695291 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

513 bp · LXL04_009543|LXL04_009543|OH1004|cDNA

ATGTTGAGGTACGCCACTAAGAGGATTCTAGGGTTGGGATTAGCTGAGACACGGTCGCCTGCTCCGGCTGTGACCCGGATTCTGCCTAGGTTTTACCACGAGAGGGTGGTGGACCATTACAACAATCCTCGTAACGTCGGTGCTTTTGATAAGAACGATCCTACGGTTGGCACAGGGCTTGTTGGTGCACCGGCTTGCGGAGATGTTATGAAGCTTCAGATTAAGGTCGATGAAGAGACTGGCAAGATTACGGATGCTTG...

CDS

Download CDS FASTA

513 bp · LXL04_009543|LXL04_009543|OH1004|CDS

ATGTTGAGGTACGCCACTAAGAGGATTCTAGGGTTGGGATTAGCTGAGACACGGTCGCCTGCTCCGGCTGTGACCCGGATTCTGCCTAGGTTTTACCACGAGAGGGTGGTGGACCATTACAACAATCCTCGTAACGTCGGTGCTTTTGATAAGAACGATCCTACGGTTGGCACAGGGCTTGTTGGTGCACCGGCTTGCGGAGATGTTATGAAGCTTCAGATTAAGGTCGATGAAGAGACTGGCAAGATTACGGATGCTTG...

Protein

Download Protein FASTA

170 aa · LXL04_009543|LXL04_009543|OH1004|PROTEIN

MLRYATKRILGLGLAETRSPAPAVTRILPRFYHERVVDHYNNPRNVGAFDKNDPTVGTGLVGAPACGDVMKLQIKVDEETGKITDACFKTFGCGSAIASSSVATEWVKGKQMEEVVTIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRGTKALETNNKAAEVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009543`
TK1151 ID	TkA03G447020
OH-1004 ID	LXL04_009543
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009543

Location Chr02:128694177-128695291 (+)

Description Similar to ISU1: Iron-sulfur cluster assembly protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22220`	Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins.	Isolation and characterization of Arabidopsis thaliana ISU1 gene.2004 · DOI: 10.1016/j.bbaexp.2004.09.005 Functional analysis of Arabidopsis genes involved in mitochondrial iron-sulfur cluster assembly.2007 · DOI: 10.1007/s11103-007-9147-x
`At4g04080`	Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins.	Functional analysis of Arabidopsis genes involved in mitochondrial iron-sulfur cluster assembly.2007 · DOI: 10.1007/s11103-007-9147-x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0662600`	Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins (Probable).	Stage- and tissue-specific expression of rice OsIsu1 gene encoding a scaffold protein for mitochondrial iron-sulfur-cluster biogenesis.2009 · DOI: 10.1007/s10529-009-0004-7

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009543 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002098 tRNA wobble uridine modification Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0044571 [2Fe-2S] cluster assembly Biological Process

GO:0044572 [4Fe-4S] cluster assembly Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005198 structural molecule activity Molecular Function

GO:0005506 iron ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G04080

ath:AT4G22220

dha:DEHA2G23958g

dosa:Os01g0662600

kla:KLLA0_D07161g

osa:4327858

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.961

Rank 1 · LXL04_009543 · OH-1004

Cytoplasm0.074

Rank 2 · LXL04_009543 · OH-1004

Nucleus0.064

Rank 3 · LXL04_009543 · OH-1004

Cell membrane0.032

Rank 4 · LXL04_009543 · OH-1004

Extracellular0.015

Rank 5 · LXL04_009543 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01592.22NifU_N32-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009543	`PF01592.22`	NifU_N	32	156	1.7e-55	187.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49627`	Arabidopsis thaliana	Iron-sulfur cluster assembly protein 1	75.449%	Swiss-Prot	strong database homology
`O81433`	Arabidopsis thaliana	Iron-sulfur cluster assembly protein 3	69.939%	Swiss-Prot	strong database homology
`Q8LR34`	Oryza sativa subsp. japonica	Iron-sulfur cluster assembly protein 1	74.706%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card