Gene Card
Gene overview
cDNA / CDS / Protein Sequences
330 bp · LXL04_009502|LXL04_009502|OH1004|cDNA
ATGCACCACCACCGTATCCTCTTCGACAAATACCATCCAGGTTACTTCGGTAAAGTCGGAATGAGGTACTTCCACAGGCTTCGCAACAAATTCCATTGCCCCATCGTGAACGTCGACAAGCTCTGGTCCATGGTCCCCGAGGATGTGAGAGAGAAGGCTTCATCTGACAAGATCCCTGTAGTCGATGTGACACAGCACGGATTCTTCAAGGTTTTGGGGAAAGGTGCGGTGCCTCTTACGCATCCGATGGTTGTGAAGGC...
330 bp · LXL04_009502|LXL04_009502|OH1004|CDS
ATGCACCACCACCGTATCCTCTTCGACAAATACCATCCAGGTTACTTCGGTAAAGTCGGAATGAGGTACTTCCACAGGCTTCGCAACAAATTCCATTGCCCCATCGTGAACGTCGACAAGCTCTGGTCCATGGTCCCCGAGGATGTGAGAGAGAAGGCTTCATCTGACAAGATCCCTGTAGTCGATGTGACACAGCACGGATTCTTCAAGGTTTTGGGGAAAGGTGCGGTGCCTCTTACGCATCCGATGGTTGTGAAGGC...
Protein
Download Protein FASTA109 aa · LXL04_009502|LXL04_009502|OH1004|PROTEIN
MHHHRILFDKYHPGYFGKVGMRYFHRLRNKFHCPIVNVDKLWSMVPEDVREKASSDKIPVVDVTQHGFFKVLGKGAVPLTHPMVVKAKLISKTAEKKIKEAGGAVLLTA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_009502 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_009502 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:127582202-127582531 (+) | |||||||||
| Description | Similar to RPL27AB: 60S ribosomal protein L27a-2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006412 translation Biological Process GO:0009791 post-embryonic development Biological Process GO:0009908 flower development Biological Process GO:0010229 inflorescence development Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005840 ribosome Cellular Component GO:0009506 plasmodesma Cellular Component GO:0015934 large ribosomal subunit Cellular Component GO:0022625 cytosolic large ribosomal subunit Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G23290 ath:AT1G70600 ddi:DDB_G0292388 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00828.26Ribosomal_L27A35-105 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_009502 | PF00828.26 | Ribosomal_L27A | 35 | 105 | 1.9e-16 | 60.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.