LXL04_009433 | RubberDandelionOmics

Gene overview

LXL04_009433

Reference: OH-1004 Chr: Chr02 Coordinates: 126542946-126553605 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2847 bp · LXL04_009433|LXL04_009433|OH1004|cDNA

ATGGGTCCCAAAGCAGAGGCGTGTGCCGAATGCACTCAGAATTGTCTCTTGATGCATAAAAAAGAGAGAATCCCATCGCCTGTTGCTACTACATTCTTCAAAGTCATGTTTGGTGACGAATATTCCAAAGTTCTGTTTCTACCTCCAAGATTTTCTCATGGCGTACAAGAAAAGGCTGGCAAGGAAACTTGGCTTGAGGATTCATATGGTGAGAAATGGAAAGTCAAATACACCGAAATTGGTGACTTATTGGCATTTGA...

CDS

Download CDS FASTA

2847 bp · LXL04_009433|LXL04_009433|OH1004|CDS

ATGGGTCCCAAAGCAGAGGCGTGTGCCGAATGCACTCAGAATTGTCTCTTGATGCATAAAAAAGAGAGAATCCCATCGCCTGTTGCTACTACATTCTTCAAAGTCATGTTTGGTGACGAATATTCCAAAGTTCTGTTTCTACCTCCAAGATTTTCTCATGGCGTACAAGAAAAGGCTGGCAAGGAAACTTGGCTTGAGGATTCATATGGTGAGAAATGGAAAGTCAAATACACCGAAATTGGTGACTTATTGGCATTTGA...

Protein

Download Protein FASTA

948 aa · LXL04_009433|LXL04_009433|OH1004|PROTEIN

MGPKAEACAECTQNCLLMHKKERIPSPVATTFFKVMFGDEYSKVLFLPPRFSHGVQEKAGKETWLEDSYGEKWKVKYTEIGDLLAFEEGWNTFCLDHRIKVGDFLVFHYIRESHFVVSMYGESGFPENRHYGFTRHQMKETRKDNKLTNVDHHIQSNAITHCNGHLSEVKDSDGSQQKETRIVKKGSDDHLVASCSRSQPSDSDKETSQRSKLLVNTNPDIDKTVCETPMIVDKNIKEDIGVDSLHDMSIPEIIPEKPSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009433`
TK1151 ID	TkA03G439840
OH-1004 ID	LXL04_009433
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 93.857 / OH-1004 58.017 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009433

Location Chr02:126542946-126553605 (-)

Description Similar to RPN7: 26S proteasome non-ATPase regulatory subunit 6 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24820`	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0485000`	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009433 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0061136 regulation of proteasomal protein catabolic process Biological Process

GO:0071357 cellular response to type I interferon Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT4G24820

bta:538625

dosa:Os04g0485000

hsa:9861

mmu:66413

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.945

Rank 1 · LXL04_009433 · OH-1004

Cytoplasm0.095

Rank 2 · LXL04_009433 · OH-1004

Cell membrane0.029

Rank 3 · LXL04_009433 · OH-1004

Endoplasmic reticulum0.016

Rank 4 · LXL04_009433 · OH-1004

Mitochondrion0.011

Rank 5 · LXL04_009433 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362.27B332-120 aa

PF10602.16RPN7625-798 aa

PF01399.34PCI839-916 aa

PF21154.3RPN7_PSMD6_C925-946 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009433	`PF02362.27`	B3	32	120	8.1e-21	74.6
LXL04_009433	`PF10602.16`	RPN7	625	798	2e-64	217.2
LXL04_009433	`PF01399.34`	PCI	839	916	2.5e-17	63.6
LXL04_009433	`PF21154.3`	RPN7_PSMD6_C	925	946	1.8e-12	47.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y35`	Arabidopsis thaliana	26S proteasome non-ATPase regulatory subunit 6 homolog	85.417%	Swiss-Prot	weak database homology
`Q8W425`	Oryza sativa subsp. japonica	26S proteasome non-ATPase regulatory subunit 6	82.990%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card