LXL04_009405 | RubberDandelionOmics

Gene overview

LXL04_009405

Reference: OH-1004 Chr: Chr02 Coordinates: 125453612-125457761 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2292 bp · LXL04_009405|LXL04_009405|OH1004|cDNA

ATGGGGATCCAGCAGGGACAGCCACCGGTGACGTCACAGCAACTATCTACTCCGCCGCGTACCAACACTGCCGACCTCTTCGGTGATCCAATTGACTCCCATCCCTTATGGTTTAAACAATCCTCATTCCTCAGCCCTGATTTCGACTCGGAATCCTACATCTCCGATCTGCGAACATTTGTCCCATTCGAAACCCTTAGATCGGAGCTGCAGTCCCATCAATCATCCCTTAAACATGAGCTCGTAGAGCTAATTAACCG...

CDS

Download CDS FASTA

2292 bp · LXL04_009405|LXL04_009405|OH1004|CDS

ATGGGGATCCAGCAGGGACAGCCACCGGTGACGTCACAGCAACTATCTACTCCGCCGCGTACCAACACTGCCGACCTCTTCGGTGATCCAATTGACTCCCATCCCTTATGGTTTAAACAATCCTCATTCCTCAGCCCTGATTTCGACTCGGAATCCTACATCTCCGATCTGCGAACATTTGTCCCATTCGAAACCCTTAGATCGGAGCTGCAGTCCCATCAATCATCCCTTAAACATGAGCTCGTAGAGCTAATTAACCG...

Protein

Download Protein FASTA

763 aa · LXL04_009405|LXL04_009405|OH1004|PROTEIN

MGIQQGQPPVTSQQLSTPPRTNTADLFGDPIDSHPLWFKQSSFLSPDFDSESYISDLRTFVPFETLRSELQSHQSSLKHELVELINRDYADFVNLSTKLVDVDAAVLRMRAPLIEIREKILGFRGAVEGSLVSLQGGLRQRAEASAAREILELLIDTSHVVSKVEKLIKELHSVPADASNGDLHTTENGHVTNGISTQHSEIGTIRRETQSMLLERIASEMNRLKFYFAHAKNLPFIENMERRIQNASSLLDTSLGHCFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009405`
TK1151 ID	TkA03G434400
OH-1004 ID	LXL04_009405
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 68.676 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009405

Location Chr02:125453612-125457761 (+)

Description Similar to COG2: Conserved oligomeric Golgi complex subunit 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24840`	Required for normal Golgi morphology and function (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009405 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000301 retrograde transport, vesicle recycling within Golgi Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0007030 Golgi organization Biological Process

GO:0007290 spermatid nucleus elongation Biological Process

GO:0015031 protein transport Biological Process

GO:0060178 regulation of exocyst localization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005795 Golgi stack Cellular Component

GO:0017119 Golgi transport complex Cellular Component

GO:0031410 cytoplasmic vesicle Cellular Component

KEGG gene cross-reference

ath:AT4G24840

ddi:DDB_G0281163

dme:Dmel_CG6177

hsa:22796

mmu:76332

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.593

Rank 1 · LXL04_009405 · OH-1004

Golgi apparatus0.340

Rank 2 · LXL04_009405 · OH-1004

Nucleus0.187

Rank 3 · LXL04_009405 · OH-1004

Lysosome / Vacuole0.125

Rank 4 · LXL04_009405 · OH-1004

Cell membrane0.116

Rank 5 · LXL04_009405 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06148.18COG2_N36-110 aa

PF12022.15COG2_C421-725 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009405	`PF06148.18`	COG2_N	36	110	2.7e-26	92.1
LXL04_009405	`PF12022.15`	COG2_C	421	725	9e-92	308.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JRR1`	Arabidopsis thaliana	Conserved oligomeric Golgi complex subunit 2	64.499%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card