LXL04_009358 | RubberDandelionOmics

Gene overview

LXL04_009358

Reference: OH-1004 Chr: Chr02 Coordinates: 123977446-123977914 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · LXL04_009358|LXL04_009358|OH1004|cDNA

ATGGCCGATCAGCTTACCGATGACCAGATCTCCGAATTCAAGGAGGCGTTCAGCCTATTCGATAAGGAAGGACATGACAAGTGGAATGGACCCCATATTGAGAACGCAAAGAAAAGTCGAGCCATTATTCTGACAACACATTCAATGGAAGAAGCTGATATTTTAAGTGATCGAATAGGAATCATGGCAAAAGGCAGGCTTCGATGCATCAAGAATTCAATCAGGTTGAAGTCAAGATTTGGTACCGGTTACATTGTTCA...

CDS

Download CDS FASTA

336 bp · LXL04_009358|LXL04_009358|OH1004|CDS

ATGGCCGATCAGCTTACCGATGACCAGATCTCCGAATTCAAGGAGGCGTTCAGCCTATTCGATAAGGAAGGACATGACAAGTGGAATGGACCCCATATTGAGAACGCAAAGAAAAGTCGAGCCATTATTCTGACAACACATTCAATGGAAGAAGCTGATATTTTAAGTGATCGAATAGGAATCATGGCAAAAGGCAGGCTTCGATGCATCAAGAATTCAATCAGGTTGAAGTCAAGATTTGGTACCGGTTACATTGTTCA...

Protein

Download Protein FASTA

111 aa · LXL04_009358|LXL04_009358|OH1004|PROTEIN

MADQLTDDQISEFKEAFSLFDKEGHDKWNGPHIENAKKSRAIILTTHSMEEADILSDRIGIMAKGRLRCIKNSIRLKSRFGTGYIVHINLSPTYHEEVKLFFKYVCHIINL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009358`
TK1151 ID	TkA08G228250
OH-1004 ID	LXL04_009358
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	94.300
Protein coverage (%)	TK1151 59.659 / OH-1004 94.595 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009358

Location Chr02:123977446-123977914 (-)

Description Similar to ABCA2: ABC transporter A family member 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47730`	ABC transporter A family member 2.	No verified direct reference in this release
`At5g61690`	ABC transporter A family member 11.	No verified direct reference in this release
`At5g61730`	Mediates the transport of acyl-CoAs and/or free fatty acids to the endoplasmic reticulum.	AtABCA9 transporter supplies fatty acids for lipid synthesis to the endoplasmic reticulum.2013 · DOI: 10.1073/pnas.1214159110
`At3g47770`	ABC transporter A family member 6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009358 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006641 triglyceride metabolic process Biological Process

GO:0006869 lipid transport Biological Process

GO:0010867 positive regulation of triglyceride biosynthetic process Biological Process

GO:0034197 triglyceride transport Biological Process

GO:0048316 seed development Biological Process

GO:0048317 seed morphogenesis Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005319 lipid transporter activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G47730

ath:AT3G47770

ath:AT5G61690

ath:AT5G61730

ddi:DDB_G0271140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.307

Rank 1 · LXL04_009358 · OH-1004

Extracellular0.188

Rank 2 · LXL04_009358 · OH-1004

Nucleus0.133

Rank 3 · LXL04_009358 · OH-1004

Peroxisome0.113

Rank 4 · LXL04_009358 · OH-1004

Mitochondrion0.087

Rank 5 · LXL04_009358 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84K47`	Arabidopsis thaliana	ABC transporter A family member 2	65.432%	Swiss-Prot	moderate database homology
`Q9FKF2`	Arabidopsis thaliana	ABC transporter A family member 11	62.963%	Swiss-Prot	moderate database homology
`Q9FLT5`	Arabidopsis thaliana	ABC transporter A family member 9	68.000%	Swiss-Prot	moderate database homology
`Q9STT6`	Arabidopsis thaliana	ABC transporter A family member 6	50.685%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card