LXL04_009356 | RubberDandelionOmics

Gene overview

LXL04_009356

Reference: OH-1004 Chr: Chr02 Coordinates: 123956445-123958421 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

690 bp · LXL04_009356|LXL04_009356|OH1004|cDNA

ATGGATTTTTTTCACAGATTCCTCAATTTTGTTGCTCCAATCGCAACCCTCTCTGCACTCTTCTTCGTCACACCGCTTTATTGCGCTTTCAAACTCTTAAGCTATATCGATCGTTCCATTTCTAAGGAAGACGTCGCCGGAAAAGTAGTTTTGATCGTCGGAGCATCTTCAGGAATCGGCGAGCATATCGCGTATGAGTACGCCAGAAGAGGAGCATGTTCGGTCCTGGCAGCTAGAAGAGAGAAGAGTCTCCGTGAAGT...

CDS

Download CDS FASTA

690 bp · LXL04_009356|LXL04_009356|OH1004|CDS

ATGGATTTTTTTCACAGATTCCTCAATTTTGTTGCTCCAATCGCAACCCTCTCTGCACTCTTCTTCGTCACACCGCTTTATTGCGCTTTCAAACTCTTAAGCTATATCGATCGTTCCATTTCTAAGGAAGACGTCGCCGGAAAAGTAGTTTTGATCGTCGGAGCATCTTCAGGAATCGGCGAGCATATCGCGTATGAGTACGCCAGAAGAGGAGCATGTTCGGTCCTGGCAGCTAGAAGAGAGAAGAGTCTCCGTGAAGT...

Protein

Download Protein FASTA

229 aa · LXL04_009356|LXL04_009356|OH1004|PROTEIN

MDFFHRFLNFVAPIATLSALFFVTPLYCAFKLLSYIDRSISKEDVAGKVVLIVGASSGIGEHIAYEYARRGACSVLAARREKSLREVSATAKFLGAPEAIAIPTDVSSINDCKRLIDQTINHFGQLNHLVNCAGVTPMCMLEEITDITSFTSGMNINFWGYVYMTYLSLPYLRKSKGKIIVIASSASWMPAPRMGLYNKPVSEIYGLRMSPKGAVQAFSGIPDSGSILT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009356`
TK1151 ID	TkA03G428720
OH-1004 ID	LXL04_009356
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 96.203 / OH-1004 66.376 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009356

Location Chr02:123956445-123958421 (+)

Description Similar to SOP2: 11-beta-hydroxysteroid dehydrogenase A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50700`	Catalyzes 11-beta, 17-beta-hydroxysteroid and reduces 17- beta-ketosteroids.	Regulation of HSD1 in seeds of Arabidopsis thaliana.2009 · DOI: 10.1093/pcp/pcp092
`At5g50600`	Catalyzes 11-beta, 17-beta-hydroxysteroid and reduces 17- beta-ketosteroids.	At5g50600 encodes a member of the short-chain dehydrogenase reductase superfamily with 11beta- and 17beta-hydroxysteroid dehydrogenase activities associated with Arabidopsis thaliana seed oil bodies.2007 · DOI: 10.1016/j.biochi.2006.09.013 A putative hydroxysteroid dehydrogenase involved in regulating plant growth and development.2007 · DOI: 10.1104/pp.107.100560 Regulation of HSD1 in seeds of Arabidopsis thaliana.2009 · DOI: 10.1093/pcp/pcp092
`At3g47350`	11-beta-hydroxysteroid dehydrogenase-like 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009356 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006694 steroid biosynthetic process Biological Process

GO:0008202 steroid metabolic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0005811 lipid droplet Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004303 estradiol 17-beta-dehydrogenase [NAD(P)+] activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0070523 11-beta-hydroxysteroid dehydrogenase (NAD+) activity Molecular Function

GO:0070524 11-beta-hydroxysteroid dehydrogenase (NADP+) activity Molecular Function

KEGG gene cross-reference

ath:AT3G47350

ath:AT5G50600

ath:AT5G50700

sind:105158152

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.451

Rank 1 · LXL04_009356 · OH-1004

Cytoplasm0.170

Rank 2 · LXL04_009356 · OH-1004

Mitochondrion0.120

Rank 3 · LXL04_009356 · OH-1004

Golgi apparatus0.118

Rank 4 · LXL04_009356 · OH-1004

Nucleus0.101

Rank 5 · LXL04_009356 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short48-197 aa

PF08659.17KR50-167 aa

PF13561.13adh_short_C254-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009356	`PF00106.32`	adh_short	48	197	8.6e-33	114.2
LXL04_009356	`PF08659.17`	KR	50	167	1.3e-07	32.5
LXL04_009356	`PF13561.13`	adh_short_C2	54	198	7.8e-22	78.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DKC6`	Arabidopsis thaliana	11-beta-hydroxysteroid dehydrogenase 1B	51.515%	Swiss-Prot	strong database homology
`P0DKC5`	Arabidopsis thaliana	11-beta-hydroxysteroid dehydrogenase 1A	51.515%	Swiss-Prot	strong database homology
`Q9STY8`	Arabidopsis thaliana	11-beta-hydroxysteroid dehydrogenase-like 2	49.495%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card