LXL04_009351 | RubberDandelionOmics

Gene overview

LXL04_009351

Reference: OH-1004 Chr: Chr02 Coordinates: 123816403-123817957 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1373 bp · LXL04_009351|LXL04_009351|OH1004|cDNA

ATTGAAATATATTCTTTTTGATGGTTCAGTTACAGGTTATTTTAAGTCTGCTAGAAATGGAAAGTAATGGAACCTACAACGGCAACCAAGGTGTCGAACTGTTAGTCACACGGATAGGAGAGCCGACACTTGTGAAACCCTTGGAGGAAACCGGAAAGGGTCTTTATTTCCTCTCTAATTTGGACCAAAATATTGCAGTCATAGTGCATACGATTTACTGCTTTAAGTCCGAGGAGAAAGGAAATGAGATGGCGGTTGAT...

CDS

Download CDS FASTA

1356 bp · LXL04_009351|LXL04_009351|OH1004|CDS

TTGATGGTTCAGTTACAGGTTATTTTAAGTCTGCTAGAAATGGAAAGTAATGGAACCTACAACGGCAACCAAGGTGTCGAACTGTTAGTCACACGGATAGGAGAGCCGACACTTGTGAAACCCTTGGAGGAAACCGGAAAGGGTCTTTATTTCCTCTCTAATTTGGACCAAAATATTGCAGTCATAGTGCATACGATTTACTGCTTTAAGTCCGAGGAGAAAGGAAATGAGATGGCGGTTGATGTGATTAAGGATGCTCT...

Protein

Download Protein FASTA

451 aa · LXL04_009351|LXL04_009351|OH1004|PROTEIN

MMVQLQVILSLLEMESNGTYNGNQGVELLVTRIGEPTLVKPLEETGKGLYFLSNLDQNIAVIVHTIYCFKSEEKGNEMAVDVIKDALSKVLVHYYPAAGRLTISPEGKIIVDCTSEGVVFVEAEANCNIKDMGDHTKPDPVTLGKLVYNIPGAKNILEFPPLVVQVTKFKCGGFVLGIGMNHNLFDGIAAMEFINSWGRIARGLPLQVKPFLDRTILKARNPPVVEFPHHEFEEIEDISNTGDLYKEELAYRSFCFSPDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009351`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009351

Location Chr02:123816403-123817957 (-)

Description Similar to HHT1: Omega-hydroxypalmitate O-feruloyl transferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41040`	Involved in the synthesis of aromatics of the suberin polymer.	Identification of an Arabidopsis feruloyl-coenzyme A transferase required for suberin synthesis.2009 · DOI: 10.1104/pp.109.144907 A hydroxycinnamoyltransferase responsible for synthesizing suberin aromatics in Arabidopsis.2009 · DOI: 10.1073/pnas.0905555106
`At5g63560`	Involved in the synthesis of alkyl hydroxycinnamates in root waxes.	Identification of an Arabidopsis fatty alcohol:caffeoyl-Coenzyme A acyltransferase required for the synthesis of alkyl hydroxycinnamates in root waxes.2012 · DOI: 10.1104/pp.112.201822
`At5g48930`	Acyltransferase involved in the biosynthesis of lignin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009351 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006084 acetyl-CoA metabolic process Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0009963 positive regulation of flavonoid biosynthetic process Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0090431 alkyl caffeate ester biosynthetic process Biological Process

GO:1901787 benzoyl-CoA metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ag:AAU06226

ath:AT5G41040

ath:AT5G48930

ath:AT5G63560

nta:107796658

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.478

Rank 1 · LXL04_009351 · OH-1004

Endoplasmic reticulum0.192

Rank 2 · LXL04_009351 · OH-1004

Nucleus0.174

Rank 3 · LXL04_009351 · OH-1004

Plastid0.097

Rank 4 · LXL04_009351 · OH-1004

Peroxisome0.084

Rank 5 · LXL04_009351 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458.21Transferase36-449 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009351	`PF02458.21`	Transferase	36	449	1.9e-94	317.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CD1`	Arabidopsis thaliana	Omega-hydroxypalmitate O-feruloyl transferase	73.634%	Swiss-Prot	strong database homology
`Q9FFQ7`	Arabidopsis thaliana	Fatty alcohol:caffeoyl-CoA acyltransferase	66.118%	Swiss-Prot	strong database homology
`Q9FI78`	Arabidopsis thaliana	Shikimate O-hydroxycinnamoyltransferase	36.092%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card