RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_009322
Reference: OH-1004 Chr: Chr02 Coordinates: 122826211-122828196 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1128 bp · LXL04_009322|LXL04_009322|OH1004|cDNA

ATGACTGGGAACATGGCTCATCTCACTCTTGCATTTGGCCTTCTTGGTAATGTCGTCTCATTTATGGTGTTTCTTGCACCAATACCAACGTTTTATAAAGTTTACAAAAAGAAATCAACCGAAGGTTTTCAGTCGGCGCCATACGTTGTGGGCTTATTCAGTGCCATGCTTTGGATATATTATGCATTGCTCAAGTCCAATGTCTTGCTTCTCATCACCATTAACTCAGTTGGTTGCATCATAGAGACCTTCTACATTTG...

CDS

Download CDS FASTA

867 bp · LXL04_009322|LXL04_009322|OH1004|CDS

ATGACTGGGAACATGGCTCATCTCACTCTTGCATTTGGCCTTCTTGGTAATGTCGTCTCATTTATGGTGTTTCTTGCACCAATACCAACGTTTTATAAAGTTTACAAAAAGAAATCAACCGAAGGTTTTCAGTCGGCGCCATACGTTGTGGGCTTATTCAGTGCCATGCTTTGGATATATTATGCATTGCTCAAGTCCAATGTCTTGCTTCTCATCACCATTAACTCAGTTGGTTGCATCATAGAGACCTTCTACATTTG...

Protein

Download Protein FASTA

288 aa · LXL04_009322|LXL04_009322|OH1004|PROTEIN

MTGNMAHLTLAFGLLGNVVSFMVFLAPIPTFYKVYKKKSTEGFQSAPYVVGLFSAMLWIYYALLKSNVLLLITINSVGCIIETFYICFFLFYAPKKARMESLKLIVLLIVVGFGLIVVLTQFLASGVTRGVIVGWICLVFSLCVFVAPLGVLRQVIKTKSVEYMPILLSVALTLSAVMWFFYGLLLGDFNIAIPNVLGFTFGIIQMILYFLYKNKKPIIDEKMPKCEEKVAELAGQKLPEFKDQKIIDVVKLKTLLHDDI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_009322
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_009322
LocationChr02:122826211-122828196 (+)
DescriptionSimilar to SWEET10: Bidirectional sugar transporter SWEET10
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g50790 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
At5g23660 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8BKP4 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
Os11g0508600 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
Sugar transporters for intercellular exchange and nutrition of pathogens.2010 · DOI: 10.1038/nature09606
Five phylogenetically close rice SWEET genes confer TAL effector-mediated susceptibility to Xanthomonas oryzae pv. oryzae.2013 · DOI: 10.1111/nph.12411
Os12g0476200 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009322 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0008643 carbohydrate transport Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0010431 seed maturation Biological Process
GO:0015770 sucrose transport Biological Process
GO:0048571 long-day photoperiodism Biological Process
GO:0051260 protein homooligomerization Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0008515 sucrose transmembrane transporter activity Molecular Function
GO:0051119 sugar transmembrane transporter activity Molecular Function
KEGG gene cross-reference
ath:AT5G23660
ath:AT5G50790
dosa:Os11g0508600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.636
Rank 1 · LXL04_009322 · OH-1004
Endoplasmic reticulum0.158
Rank 2 · LXL04_009322 · OH-1004
Lysosome / Vacuole0.111
Rank 3 · LXL04_009322 · OH-1004
Cytoplasm0.102
Rank 4 · LXL04_009322 · OH-1004
Golgi apparatus0.074
Rank 5 · LXL04_009322 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083.22MtN3_slv12-96 aa
PF03083.22MtN3_slv132-216 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_009322PF03083.22MtN3_slv12963.6e-53178.3
LXL04_009322PF03083.22MtN3_slv1322163.6e-53178.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LUE3Arabidopsis thalianaBidirectional sugar transporter SWEET1050.929%Swiss-Protstrong database homology
O82587Arabidopsis thalianaBidirectional sugar transporter SWEET1253.357%Swiss-Protstrong database homology
B8BKP4Oryza sativa subsp. indicaBidirectional sugar transporter SWEET1451.648%Swiss-Protstrong database homology
Q2R3P9Oryza sativa subsp. japonicaBidirectional sugar transporter SWEET1451.648%Swiss-Protstrong database homology
Q2QR07Oryza sativa subsp. japonicaBidirectional sugar transporter SWEET1354.406%Swiss-Protstrong database homology

JBrowse

View in Genome Browser