LXL04_009284 | RubberDandelionOmics

Gene overview

LXL04_009284

Reference: OH-1004 Chr: Chr02 Coordinates: 122007791-122011857 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1731 bp · LXL04_009284|LXL04_009284|OH1004|cDNA

ATGGGCAATTGCTGTGATGGTGGCGGCCAATCTGCCATCGGCGGATCTTCTCATCCAAATGCTAATGCTCATAACGACGCCGTTGATGGTTTTCTTAAATCTCGTGGCTACCATGGTCTTTACACTGAGATCGAGCTATCTATATCTGCTTCAAATTTGCGTGACCGAGATGTCCTCTCCAAGAGTGATCCTATGGCAGTTATATATACAAAAGGAAGGGACGGGTCATTGCAAGAGATTGGGCGTACTGAAGTTGTCCT...

CDS

Download CDS FASTA

1731 bp · LXL04_009284|LXL04_009284|OH1004|CDS

ATGGGCAATTGCTGTGATGGTGGCGGCCAATCTGCCATCGGCGGATCTTCTCATCCAAATGCTAATGCTCATAACGACGCCGTTGATGGTTTTCTTAAATCTCGTGGCTACCATGGTCTTTACACTGAGATCGAGCTATCTATATCTGCTTCAAATTTGCGTGACCGAGATGTCCTCTCCAAGAGTGATCCTATGGCAGTTATATATACAAAAGGAAGGGACGGGTCATTGCAAGAGATTGGGCGTACTGAAGTTGTCCT...

Protein

Download Protein FASTA

576 aa · LXL04_009284|LXL04_009284|OH1004|PROTEIN

MGNCCDGGGQSAIGGSSHPNANAHNDAVDGFLKSRGYHGLYTEIELSISASNLRDRDVLSKSDPMAVIYTKGRDGSLQEIGRTEVVLNSLTPQWIKKIIINYHFEMVQTLLFRVYDVDTQFHGVEEKMLKLEEQQLLGEGTCLLSEIVTRKNRTLPIDLVKKLEPSSSNHPMKSGQLSIHAEECVVSKTTTELVFRCMDLENKERFSKSDPFLVISKSVESGHVVPICKTEVVQNDLNPMWKPISISISQVGSKETPLII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009284`
TK1151 ID	TkA03G415830
OH-1004 ID	LXL04_009284
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009284

Location Chr02:122007791-122011857 (+)

Description Similar to BON2: Protein BONZAI 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07300`	Negative regulator of cell death and defense responses.	The BON/CPN gene family represses cell death and promotes cell growth in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02585.x
`At5g61900`	Negative regulator of cell death and defense responses.	A haplotype-specific Resistance gene regulated by BONZAI1 mediates temperature-dependent growth control in Arabidopsis.2004 · DOI: 10.1105/tpc.020479 The BON/CPN gene family represses cell death and promotes cell growth in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02585.x Evidence that the BONZAI1/COPINE1 protein is a calcium- and pathogen-responsive defense suppressor.2009 · DOI: 10.1007/s11103-008-9413-6 Multiple R-like genes are negatively regulated by BON1 and BON3 in arabidopsis.2009 · DOI: 10.1094/mpmi-22-7-0840 Requirement of calcium binding, myristoylation, and protein-protein interaction for the Copine BON1 function in Arabidopsis.2010 · DOI: 10.1074/jbc.m109.066100
`At1g08860`	Negative regulator of cell death and defense responses.	The BON/CPN gene family represses cell death and promotes cell growth in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02585.x Multiple R-like genes are negatively regulated by BON1 and BON3 in arabidopsis.2009 · DOI: 10.1094/mpmi-22-7-0840

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009284 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009270 response to humidity Biological Process

GO:0019725 cellular homeostasis Biological Process

GO:0030335 positive regulation of cell migration Biological Process

GO:0038128 ERBB2 signaling pathway Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0045793 positive regulation of cell size Biological Process

GO:0046474 glycerophospholipid biosynthetic process Biological Process

GO:0071277 cellular response to calcium ion Biological Process

GO:0071363 cellular response to growth factor stimulus Biological Process

GO:0090332 stomatal closure Biological Process

KEGG gene cross-reference

ath:AT1G08860

ath:AT5G07300

ath:AT5G61900

hsa:8895

mmu:70568

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.500

Rank 1 · LXL04_009284 · OH-1004

Cell membrane0.295

Rank 2 · LXL04_009284 · OH-1004

Nucleus0.263

Rank 3 · LXL04_009284 · OH-1004

Golgi apparatus0.097

Rank 4 · LXL04_009284 · OH-1004

Lysosome / Vacuole0.095

Rank 5 · LXL04_009284 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168.37C248-150 aa

PF00168.37C2194-285 aa

PF07002.23Copine358-573 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009284	`PF00168.37`	C2	48	150	1.1e-25	90.6
LXL04_009284	`PF00168.37`	C2	194	285	1.1e-25	90.6
LXL04_009284	`PF07002.23`	Copine	358	573	1.2e-79	267.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5S1W2`	Arabidopsis thaliana	Protein BONZAI 2	67.535%	Swiss-Prot	strong database homology
`Q941L3`	Arabidopsis thaliana	Protein BONZAI 1	67.986%	Swiss-Prot	strong database homology
`Q5XQC7`	Arabidopsis thaliana	Protein BONZAI 3	60.103%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card