LXL04_009240 | RubberDandelionOmics

Gene overview

LXL04_009240

Reference: OH-1004 Chr: Chr02 Coordinates: 121193393-121194565 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1023 bp · LXL04_009240|LXL04_009240|OH1004|cDNA

ATGAGCTCCAGGACACCACAATCAACCGGCAGAACCCAATCACTATTCTTCAACGACTTAGCAACTCCGGTCACAAACCGCCGCAGCGGCTCCACCAAATTCACAACCCCCGGCCAAGCCGCCGCCGTCTCCGCCCTCTGGCGTGAAAATTTCGCCACCTCAGACCTCCCTCCACCGCCTGTCTTCACCCTCGAAGACCGCTCCGACTTCTCCCCCGAACCAGACTACCCCCTCCCTAACTCCTCCCCCGACCACACCAA...

CDS

Download CDS FASTA

1023 bp · LXL04_009240|LXL04_009240|OH1004|CDS

ATGAGCTCCAGGACACCACAATCAACCGGCAGAACCCAATCACTATTCTTCAACGACTTAGCAACTCCGGTCACAAACCGCCGCAGCGGCTCCACCAAATTCACAACCCCCGGCCAAGCCGCCGCCGTCTCCGCCCTCTGGCGTGAAAATTTCGCCACCTCAGACCTCCCTCCACCGCCTGTCTTCACCCTCGAAGACCGCTCCGACTTCTCCCCCGAACCAGACTACCCCCTCCCTAACTCCTCCCCCGACCACACCAA...

Protein

Download Protein FASTA

340 aa · LXL04_009240|LXL04_009240|OH1004|PROTEIN

MSSRTPQSTGRTQSLFFNDLATPVTNRRSGSTKFTTPGQAAAVSALWRENFATSDLPPPPVFTLEDRSDFSPEPDYPLPNSSPDHTNSPNPKSTPLHTPSKSLFPKTPNKSPSPFSSSPPTNSNPATSSVGGPHGGSSWWSPAGKGAGSGSGSPVDGVVHRQPGALVILPPPREVARPELERNSSLPLGVGTVDEEEWVTIYGFSPGDTNLVLREFEKCGVILKHVPGPRDSNWMHILYQSRFDAQKALGKNGMQLNGAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009240`
TK1151 ID	TkA03G412430
OH-1004 ID	LXL04_009240
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009240

Location Chr02:121193393-121194565 (-)

Description Similar to NUP35: Nuclear pore complex protein NUP35

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16310`	Nuclear pore complex protein NUP35.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009240 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006607 NLS-bearing protein import into nucleus Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0006999 nuclear pore organization Biological Process

GO:0051028 mRNA transport Biological Process

GO:1990830 cellular response to leukemia inhibitory factor Biological Process

GO:0005635 nuclear envelope Cellular Component

GO:0005652 nuclear lamina Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0044613 nuclear pore central transport channel Cellular Component

KEGG gene cross-reference

ath:AT3G16310

dre:337461

hsa:129401

mmu:69482

rno:295692

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.506

Rank 1 · LXL04_009240 · OH-1004

Nucleus0.491

Rank 2 · LXL04_009240 · OH-1004

Cell membrane0.058

Rank 3 · LXL04_009240 · OH-1004

Golgi apparatus0.044

Rank 4 · LXL04_009240 · OH-1004

Lysosome / Vacuole0.038

Rank 5 · LXL04_009240 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05172.20RRM_Nup35194-276 aa

PF14605.13Nup35_RRM_2197-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009240	`PF05172.20`	RRM_Nup35	194	276	2e-30	105.3
LXL04_009240	`PF14605.13`	Nup35_RRM_2	197	249	6.4e-09	36.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04326`	Arabidopsis thaliana	Nuclear pore complex protein NUP35	56.069%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card