LXL04_009233 | RubberDandelionOmics

Gene overview

LXL04_009233

Reference: OH-1004 Chr: Chr02 Coordinates: 121082938-121092484 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3420 bp · LXL04_009233|LXL04_009233|OH1004|cDNA

ATGCATAAAGAAGGACCCATAAGCCTCGTGGGTCTTGTATCCAAAATCTTAGCGAAAACCTTAGCCCTCCACCTAAAAAAGGTTCTTCATCTCATTATTAATCCCATCCAGTCGGCTTTTGTGCAGGAAAGACAGATTTTGGACGGTCCTTTAATCATTAACGAGACGATCGATTGGGctaaaaagaagaagaagaaggtgtTTCTTCTCAAAACGGATATCGCTAAGGCCTACGACTCTGTCTCGTGGAGCTATCTGGA...

CDS

Download CDS FASTA

3420 bp · LXL04_009233|LXL04_009233|OH1004|CDS

ATGCATAAAGAAGGACCCATAAGCCTCGTGGGTCTTGTATCCAAAATCTTAGCGAAAACCTTAGCCCTCCACCTAAAAAAGGTTCTTCATCTCATTATTAATCCCATCCAGTCGGCTTTTGTGCAGGAAAGACAGATTTTGGACGGTCCTTTAATCATTAACGAGACGATCGATTGGGCTAAAAAGAAGAAGAAGAAGGTGTTTCTTCTCAAAACGGATATCGCTAAGGCCTACGACTCTGTCTCGTGGAGCTATCTGGA...

Protein

Download Protein FASTA

1139 aa · LXL04_009233|LXL04_009233|OH1004|PROTEIN

MHKEGPISLVGLVSKILAKTLALHLKKVLHLIINPIQSAFVQERQILDGPLIINETIDWAKKKKKKVFLLKTDIAKAYDSVSWSYLDKIMDAMNFGSKWRRWIHACLSSSAMSVLVNGSPTEEFTMRQGLRQGDPISPLLFTLVMEGLSLAINKAVETGFFKDLKVGKNNFSLSHLFFADDAVFIGEWNLDNAISIIGILMCFRKASGLQVNYQKSRLYGIGLDHESVTNMANLLGCKAEKLPTVFLGIPIGENMKRVEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009233`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009233

Location Chr02:121082938-121092484 (+)

Description Similar to HDR1: Protein HEADING DATE REPRESSOR 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65750`	Putative ribonuclease H protein At1g65750.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0793900`	Regulates flowering time via a photoperiod-dependent pathway.	The Oryza sativa Regulator HDR1 Associates with the Kinase OsK4 to Control Photoperiodic Flowering.2016 · DOI: 10.1371/journal.pgen.1005927
`UniProt: B8AE37`	Regulates flowering time via a photoperiod-dependent pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009233 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0032197 retrotransposition Biological Process

GO:0090304 nucleic acid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004523 RNA-DNA hybrid ribonuclease activity Molecular Function

GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

dosa:Os02g0793900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.296

Rank 1 · LXL04_009233 · OH-1004

Nucleus0.231

Rank 2 · LXL04_009233 · OH-1004

Cell membrane0.187

Rank 3 · LXL04_009233 · OH-1004

Plastid0.110

Rank 4 · LXL04_009233 · OH-1004

Endoplasmic reticulum0.106

Rank 5 · LXL04_009233 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078.33RVT_16-249 aa

PF13966.12zf-RVT524-606 aa

PF06699.17PIG-F767-922 aa

PF30963.1HDR11000-1116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009233	`PF00078.33`	RVT_1	6	249	2.9e-26	93.3
LXL04_009233	`PF13966.12`	zf-RVT	524	606	1.3e-16	61.7
LXL04_009233	`PF06699.17`	PIG-F	767	922	2.2e-37	129.7
LXL04_009233	`PF30963.1`	HDR1	1000	1116	3.3e-66	221.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C2F6`	Arabidopsis thaliana	Putative ribonuclease H protein At1g65750	30.769%	Swiss-Prot	weak database homology
`Q6K678`	Oryza sativa subsp. japonica	Protein HEADING DATE REPRESSOR 1	59.512%	Swiss-Prot	weak database homology
`B8AE37`	Oryza sativa subsp. indica	Protein HEADING DATE REPRESSOR 1	59.512%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card