Gene Card
Gene overview
cDNA / CDS / Protein Sequences
480 bp · LXL04_009180|LXL04_009180|OH1004|cDNA
ATGGGTAGTGCATCATCTACTCTAACTCAATATGATATCGAAGACGTTCAAGAACACTGTAATAATCTATTTTCCCAGCAAGAGATAGTCTCTTTATATCAAAGATTTTGCCAACTCGATCGAACTGCCAAGGGTTTTATTTCCGCCGAAGAGTTCTTATCAGTACCAGAATTTGCGGTGAATCCTCTGTCTCAGAGATTGCTTAAGATGGTGGATGGTTTGAACTTTAAGGACTTTGTGATATTCTTGTCAGCTTTTAG...
480 bp · LXL04_009180|LXL04_009180|OH1004|CDS
ATGGGTAGTGCATCATCTACTCTAACTCAATATGATATCGAAGACGTTCAAGAACACTGTAATAATCTATTTTCCCAGCAAGAGATAGTCTCTTTATATCAAAGATTTTGCCAACTCGATCGAACTGCCAAGGGTTTTATTTCCGCCGAAGAGTTCTTATCAGTACCAGAATTTGCGGTGAATCCTCTGTCTCAGAGATTGCTTAAGATGGTGGATGGTTTGAACTTTAAGGACTTTGTGATATTCTTGTCAGCTTTTAG...
Protein
Download Protein FASTA159 aa · LXL04_009180|LXL04_009180|OH1004|PROTEIN
MGSASSTLTQYDIEDVQEHCNNLFSQQEIVSLYQRFCQLDRTAKGFISAEEFLSVPEFAVNPLSQRLLKMVDGLNFKDFVIFLSAFSPKASMPQKIELIFKVYDSDYNGKVTFNDIMEEVLIKVMQEAGYSKDSSLLVDDFVKILDHPGLKMEVEVPVD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_009180 |
|---|---|
| TK1151 ID | TkA03G405800 |
| OH-1004 ID | LXL04_009180 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 90.900 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_009180 |
|---|---|
| Location | Chr02:119657822-119658922 (+) |
| Description | Similar to CNB1: Calcineurin subunit B |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006873 intracellular monoatomic ion homeostasis Biological Process GO:0043157 response to cation stress Biological Process GO:0071444 cellular response to pheromone Biological Process GO:0071466 cellular response to xenobiotic stimulus Biological Process GO:0071852 fungal-type cell wall organization or biogenesis Biological Process GO:0097720 calcineurin-mediated signaling Biological Process GO:0005955 calcineurin complex Cellular Component GO:0004723 calcium-dependent protein serine/threonine phosphatase activity Molecular Function GO:0005509 calcium ion binding Molecular Function GO:0008597 calcium-dependent protein serine/threonine phosphatase regulator activity Molecular Function GO:0019902 phosphatase binding Molecular Function GO:0019903 protein phosphatase binding Molecular Function |
| KEGG gene cross-reference | ddi:DDB_G0267446 ddi:DDB_G0285999 ncr:NCU03833 ngr:NAEGRDRAFT_35722 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13499.13EF-hand_731-118 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_009180 | PF13499.13 | EF-hand_7 | 31 | 118 | 3.7e-08 | 34.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.