LXL04_009161 | RubberDandelionOmics

Gene overview

LXL04_009161

Reference: OH-1004 Chr: Chr02 Coordinates: 119214266-119219557 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

990 bp · LXL04_009161|LXL04_009161|OH1004|cDNA

ATGGCTACCAGGGAGGCGGTGTAACATGCTTTTCGAGTCACATCTTACGGCATCGCCGACTCAGACGGTGAAAGCCGATCAGCCGACCGGAAAATACTCTTCTCCGACGTGGTGATCACCGGCACCAGAAACAACTTTTGGGGTCGAAAATGGCGGACGATCGACATCCAGGTGGCGTCATGGGTTACTTTTGTTCATGTTCTTGCACTCTTTGCACCATTTACATTCTCGTGGGATGCTTTCGCCGTCGCATTCGTCGG...

CDS

Download CDS FASTA

726 bp · LXL04_009161|LXL04_009161|OH1004|CDS

CTGTTAACCGGACTTGTTGGTATTACTCTCACATATCACCGGCTTTTAGCGCACAAGAGTCTCCGGCTGCCTAAATGGCTCGAGTACACTTGTGTTTATTTCGGGGTCTTAGCCGCCCAGCGAGATCCGATATTTTGGGTGAGCATGCATAGATATCATCACCAATATGTCGATTCAAATAAAGATACCCACTCACCCATCAACGGGTTCTGGTTCAGCCATATGGGCTGGCTTTTTGACAGCGGATACATTCTTGAAAA...

Protein

Download Protein FASTA

241 aa · LXL04_009161|LXL04_009161|OH1004|PROTEIN

MLTGLVGITLTYHRLLAHKSLRLPKWLEYTCVYFGVLAAQRDPIFWVSMHRYHHQYVDSNKDTHSPINGFWFSHMGWLFDSGYILEKYKERKNVEDLKKQAFYMFIRKTYMWHIIGCGGLLYAWGGFPFLVWGLGVRTIWVYHLTFLVNSACHIWGNQVWNTGDLSKNNWWVAVLTFGEGWHNNHHAFEYSARHGLEWWQIDVSWYIIRFLELVGLATNVKVPTDAQKLKKANFSFDNKLK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009161`
TK1151 ID	TkA03G403700
OH-1004 ID	LXL04_009161
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 73.252 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009161

Location Chr02:119214266-119219557 (-)

Description Similar to ADS3: Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15850`	Fatty acid desaturase involved in the first desaturation step leading to the formation of hexadeca 7,10,13-trienoic acid (16:3(7Z,10Z,13Z)), the major functional components of thylakoid membranes.	Switching desaturase enzyme specificity by alternate subcellular targeting.2004 · DOI: 10.1073/pnas.0402200101 Identification of the Arabidopsis palmitoyl-monogalactosyldiacylglycerol delta7-desaturase gene FAD5, and effects of plastidial retargeting of Arabidopsis desaturases on the fad5 mutant phenotype.2004 · DOI: 10.1104/pp.104.052951
`At1g06080`	Involved in delta-9 desaturation of fatty acids (Probable).	Involvement of Arabidopsis ACYL-COENZYME A DESATURASE-LIKE2 (At2g31360) in the biosynthesis of the very-long-chain monounsaturated fatty acid components of membrane lipids.2013 · DOI: 10.1104/pp.112.202325
`At2g31360`	Involved in delta-9 desaturation of fatty acids (Probable).	Switching desaturase enzyme specificity by alternate subcellular targeting.2004 · DOI: 10.1073/pnas.0402200101 Involvement of Arabidopsis ACYL-COENZYME A DESATURASE-LIKE2 (At2g31360) in the biosynthesis of the very-long-chain monounsaturated fatty acid components of membrane lipids.2013 · DOI: 10.1104/pp.112.202325 ACYL-LIPID DESATURASE2 is required for chilling and freezing tolerance in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111179 Characterization of delta 9 acyl-lipid desaturase homologues from Arabidopsis thaliana.1998 · DOI: 10.1093/oxfordjournals.pcp.a029364

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009161 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0010114 response to red light Biological Process

GO:0010205 photoinhibition Biological Process

GO:0031408 oxylipin biosynthetic process Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0031969 chloroplast membrane Cellular Component

KEGG gene cross-reference

ag:AAG28599

ath:AT1G06080

ath:AT2G31360

ath:AT3G15850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.882

Rank 1 · LXL04_009161 · OH-1004

Mitochondrion0.072

Rank 2 · LXL04_009161 · OH-1004

Cytoplasm0.056

Rank 3 · LXL04_009161 · OH-1004

Cell membrane0.048

Rank 4 · LXL04_009161 · OH-1004

Nucleus0.025

Rank 5 · LXL04_009161 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00487.31FA_desaturase4-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009161	`PF00487.31`	FA_desaturase	4	201	2.1e-14	54.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949X0`	Arabidopsis thaliana	Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic	63.793%	Swiss-Prot	strong database homology
`O65797`	Arabidopsis thaliana	Delta-9 acyl-lipid desaturase 1	58.696%	Swiss-Prot	strong database homology
`Q9SID2`	Arabidopsis thaliana	Delta-9 acyl-lipid desaturase 2	58.952%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card