LXL04_009075 | RubberDandelionOmics

Gene overview

LXL04_009075

Reference: OH-1004 Chr: Chr02 Coordinates: 117469623-117471691 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1263 bp · LXL04_009075|LXL04_009075|OH1004|cDNA

ATGGATCTTAAAACCTCCAAGTACCCTCAGGTGAAAGATAGAGATAACCCGTTTGATGATCCTTTTCCTGATTCTGTCAAGGAGACTACCGATTTGGTTAAGCTGTTTCCAATGGCGAAAAGAGATGGAGGTCCGATGAAGGGGAGTGGAATGGAAGCTCCGCCTACACCGGGTCGATCTGTTTTCAGCTTCAGCGTCGGGTCGAGAAAGAACGTTCCTTCGAAATGGGACGATGCTGAAAAATGGCTGATTAGTGGTTC...

CDS

Download CDS FASTA

1263 bp · LXL04_009075|LXL04_009075|OH1004|CDS

ATGGATCTTAAAACCTCCAAGTACCCTCAGGTGAAAGATAGAGATAACCCGTTTGATGATCCTTTTCCTGATTCTGTCAAGGAGACTACCGATTTGGTTAAGCTGTTTCCAATGGCGAAAAGAGATGGAGGTCCGATGAAGGGGAGTGGAATGGAAGCTCCGCCTACACCGGGTCGATCTGTTTTCAGCTTCAGCGTCGGGTCGAGAAAGAACGTTCCTTCGAAATGGGACGATGCTGAAAAATGGCTGATTAGTGGTTC...

Protein

Download Protein FASTA

420 aa · LXL04_009075|LXL04_009075|OH1004|PROTEIN

MDLKTSKYPQVKDRDNPFDDPFPDSVKETTDLVKLFPMAKRDGGPMKGSGMEAPPTPGRSVFSFSVGSRKNVPSKWDDAEKWLISGSDSPAHQHLNGFAKSPDFVGRTQRQENHHKTEVSSGITEEKVSKAFQEDHHHHHHHNSNRPFNGVSPSDVLLKDKFTNGTEPDYSRFKCVVPINEGFLFSPMKDASTEVVHEVKRRDTGTNTTPPRGSTASQFESFSPPPNNTPAMSGPLSLMDPSSSFDIGELHECHLAKLQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009075`
TK1151 ID	TkA03G396430
OH-1004 ID	LXL04_009075
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009075

Location Chr02:117469623-117471691 (+)

Description Similar to At3g61260: Uncharacterized protein At3g61260

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61260`	Uncharacterized protein At3g61260.	No verified direct reference in this release
`At3g57540`	Collaborates with REM4.2 to positively regulate the BCTV and BSCTV susceptibility.	Arabidopsis thaliana Remorins Interact with SnRK1 and Play a Role in Susceptibility to Beet Curly Top Virus and Beet Severe Curly Top Virus.2014 · DOI: 10.5423/ppj.oa.06.2014.0061
`At2g41870`	Collaborates with REM4.1 to positively regulate the BCTV and BSCTV susceptibility.	No verified direct reference in this release
`At2g45820`	Exhibits a non sequence-specific DNA-binding activity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009075 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007267 cell-cell signaling Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010555 response to mannitol Biological Process

GO:0051607 defense response to virus Biological Process

GO:0051665 membrane raft localization Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G41870

ath:AT2G45820

ath:AT3G57540

ath:AT3G61260

sot:102577743

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.435

Rank 1 · LXL04_009075 · OH-1004

Cell membrane0.357

Rank 2 · LXL04_009075 · OH-1004

Nucleus0.343

Rank 3 · LXL04_009075 · OH-1004

Endoplasmic reticulum0.055

Rank 4 · LXL04_009075 · OH-1004

Golgi apparatus0.053

Rank 5 · LXL04_009075 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03763.19Remorin_C300-389 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009075	`PF03763.19`	Remorin_C	300	389	7.2e-21	74.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2D8`	Arabidopsis thaliana	Uncharacterized protein At3g61260	30.088%	Swiss-Prot	weak database homology
`Q93YN8`	Arabidopsis thaliana	Remorin 4.1	32.955%	Swiss-Prot	weak database homology
`P93758`	Arabidopsis thaliana	Remorin 4.2	33.333%	Swiss-Prot	weak database homology
`O80837`	Arabidopsis thaliana	Remorin	34.513%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card