LXL04_009042 | RubberDandelionOmics

Gene overview

LXL04_009042

Reference: OH-1004 Chr: Chr02 Coordinates: 116749744-116752745 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1716 bp · LXL04_009042|LXL04_009042|OH1004|cDNA

ATGGTGGCCTCCACCGTCGCTTCCCCACTCTGTACATGGTTCGTGGCTGCTTACATGTCTGTTTCCGGTGACAAAACCAACCACCGTTCCAACCCCTCTCCGGCTCTGTTTTCTTCCTCAAAAAGACTCAGTCGGTCAGCCAGAAGGAAGTTGCCGGCGGTGACAGAATGCAACAATTTCTCCGGTGGCGGTGGATTGATGTCATCGTTTTGCGGGTCTAGTATTACGAACCTGATGACTTCATTGGAGCCCTGTGAGGA...

CDS

Download CDS FASTA

1716 bp · LXL04_009042|LXL04_009042|OH1004|CDS

ATGGTGGCCTCCACCGTCGCTTCCCCACTCTGTACATGGTTCGTGGCTGCTTACATGTCTGTTTCCGGTGACAAAACCAACCACCGTTCCAACCCCTCTCCGGCTCTGTTTTCTTCCTCAAAAAGACTCAGTCGGTCAGCCAGAAGGAAGTTGCCGGCGGTGACAGAATGCAACAATTTCTCCGGTGGCGGTGGATTGATGTCATCGTTTTGCGGGTCTAGTATTACGAACCTGATGACTTCATTGGAGCCCTGTGAGGA...

Protein

Download Protein FASTA

571 aa · LXL04_009042|LXL04_009042|OH1004|PROTEIN

MVASTVASPLCTWFVAAYMSVSGDKTNHRSNPSPALFSSSKRLSRSARRKLPAVTECNNFSGGGGLMSSFCGSSITNLMTSLEPCEEYYKSKPLSSSWSIFPSENGFSIFGLPNSCPSSTNRSRKRINRAVQTDKTMAIAVQPAKEPTTNKKPITKNRRVVVTGLGVVSPVGDLADVFYENLLEGVSGISEIEAFNCDQFPTKIAGEIKSFSADGWVAPKLSKRADKFMLYLLTAGKKALEDGGVTKDVMKELDVTKCGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009042`
TK1151 ID	TkA03G394490
OH-1004 ID	LXL04_009042
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009042

Location Chr02:116749744-116752745 (+)

Description Similar to KAS2: 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74960`	Essential protein that catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP.	A KAS2 cDNA complements the phenotypes of the Arabidopsis fab1 mutant that differs in a single residue bordering the substrate binding pocket.2002 · DOI: 10.1046/j.1365-313x.2002.01253.x A Mutant of Arabidopsis Deficient in the Elongation of Palmitic Acid.1994 · DOI: 10.1104/pp.106.1.143 Elevated Levels of High-Melting-Point Phosphatidylglycerols Do Not Induce Chilling Sensitivity in an Arabidopsis Mutant.1995 · DOI: 10.1105/tpc.7.1.17 Modulating seed beta-ketoacyl-acyl carrier protein synthase II level converts the composition of a temperate seed oil to that of a palm-like tropical oil.2007 · DOI: 10.1073/pnas.0611141104 Expression and developmental function of the 3-ketoacyl-ACP synthase2 gene in Arabidopsis thaliana.2008 · DOI: 10.1266/ggs.83.143 Low-temperature damage and subsequent recovery of fab1 mutant Arabidopsis exposed to 2 degrees C.1997 · DOI: 10.1104/pp.113.2.347
`At5g46290`	Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009042 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity Molecular Function

KEGG gene cross-reference

ath:AT1G74960

ath:AT5G46290

syn:sll1069

vch:VC_2019

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · LXL04_009042 · OH-1004

Mitochondrion0.041

Rank 2 · LXL04_009042 · OH-1004

Cytoplasm0.018

Rank 3 · LXL04_009042 · OH-1004

Peroxisome0.016

Rank 4 · LXL04_009042 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_009042 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00109.33ketoacyl-synt158-403 aa

PF02801.29Ketoacyl-synt_C411-525 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009042	`PF00109.33`	ketoacyl-synt	158	403	2.7e-54	185.1
LXL04_009042	`PF02801.29`	Ketoacyl-synt_C	411	525	4.1e-35	121.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9P4`	Arabidopsis thaliana	3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic	66.316%	Swiss-Prot	strong database homology
`P52410`	Arabidopsis thaliana	3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic	56.190%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card