RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_009018
Reference: OH-1004 Chr: Chr02 Coordinates: 116262943-116271842 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

651 bp · LXL04_009018|LXL04_009018|OH1004|cDNA

ATGGGGCGGAGGAAACTCGAAATTAAGCGGATTCAGAATAAGAGTAGCAGGCTAGTGGCGTTTTCAAAGCGTAGATCAGGATTATTTAAGAAAGCACGACACCTTTCTGTGCTCTGTGATGTTGATGTCGCCGCCGTCGTGATCTCCGATAGCGGGAAGGTTTATGAGTTCTCCAGCGGTGATACTAACAGTCTAACTATCTATTTTTCTTACTTCAATGTGGGGCTTATTCTTTCTAGACATCCGAACAGTTGGCTTCA...

CDS

Download CDS FASTA

651 bp · LXL04_009018|LXL04_009018|OH1004|CDS

ATGGGGCGGAGGAAACTCGAAATTAAGCGGATTCAGAATAAGAGTAGCAGGCTAGTGGCGTTTTCAAAGCGTAGATCAGGATTATTTAAGAAAGCACGACACCTTTCTGTGCTCTGTGATGTTGATGTCGCCGCCGTCGTGATCTCCGATAGCGGGAAGGTTTATGAGTTCTCCAGCGGTGATACTAACAGTCTAACTATCTATTTTTCTTACTTCAATGTGGGGCTTATTCTTTCTAGACATCCGAACAGTTGGCTTCA...

Protein

Download Protein FASTA

216 aa · LXL04_009018|LXL04_009018|OH1004|PROTEIN

MGRRKLEIKRIQNKSSRLVAFSKRRSGLFKKARHLSVLCDVDVAAVVISDSGKVYEFSSGDTNSLTIYFSYFNVGLILSRHPNSWLQPEEQTTQEEACKNMGLFSNLCTRFRTCKQLLESVKRVDEEPDEVSLTDMADLEQELTHALMHTRSRKTQLMMERISSFREQERILTEKNEQLKHQKYEVHDGGGDFANNHNNYQSSNTNQLLTLPLFKE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_009018
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_009018
LocationChr02:116262943-116271842 (-)
DescriptionSimilar to AGL31: Agamous-like MADS-box protein AGL31
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g65050 Probable transcription factor that prevents vernalization by short periods of cold. No verified direct reference in this release
At5g65060 Probable transcription factor involved in the negative regulation of flowering time, probably through the photoperiodic and vernalization pathways; more efficient in cv. No verified direct reference in this release
At1g77080 Probable transcription factor involved in the negative regulation of flowering time in both long and short days, probably through the photoperiodic and vernalization pathways. No verified direct reference in this release
At2g45650 Probable transcription factor. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0682200 Probable transcription factor.
MOSAIC FLORAL ORGANS1, an AGL6-like MADS box gene, regulates floral organ identity and meristem fate in rice.2009 · DOI: 10.1105/tpc.109.068742
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009018 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0009553 embryo sac development Biological Process
GO:0009908 flower development Biological Process
GO:0009909 regulation of flower development Biological Process
GO:0009910 negative regulation of flower development Biological Process
GO:0009911 positive regulation of flower development Biological Process
GO:0010022 meristem determinacy Biological Process
GO:0010048 vernalization response Biological Process
GO:0010093 specification of floral organ identity Biological Process
GO:0010094 specification of carpel identity Biological Process
KEGG gene cross-reference
ath:AT1G77080
ath:AT2G45650
ath:AT5G65050
ath:AT5G65060
dosa:Os02g0682200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.945
Rank 1 · LXL04_009018 · OH-1004
Cytoplasm0.144
Rank 2 · LXL04_009018 · OH-1004
Cell membrane0.025
Rank 3 · LXL04_009018 · OH-1004
Endoplasmic reticulum0.015
Rank 4 · LXL04_009018 · OH-1004
Mitochondrion0.010
Rank 5 · LXL04_009018 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319.24SRF-TF10-57 aa
PF01486.23K-box126-182 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_009018PF00319.24SRF-TF10572.5e-2278.7
LXL04_009018PF01486.23K-box1261823e-1144.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FPN7Arabidopsis thalianaAgamous-like MADS-box protein AGL3137.668%Swiss-Protmoderate database homology
Q9LSR7Arabidopsis thalianaAgamous-like MADS-box protein AGL7040.217%Swiss-Protmoderate database homology
Q9AT76Arabidopsis thalianaAgamous-like MADS-box protein AGL2743.478%Swiss-Protmoderate database homology
P29386Arabidopsis thalianaAgamous-like MADS-box protein AGL642.541%Swiss-Protmoderate database homology
Q6EU39Oryza sativa subsp. japonicaMADS-box transcription factor 642.051%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser