Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1194 bp · LXL04_008954|LXL04_008954|OH1004|cDNA
ATGGATTCGGACCTCAAAGGCCCGTCCTCAAAACCCCACTCCCAACATTGTGAATTAAATCTCGAAGAGGGTCATATTAAAGATGTTTCCCCCCTCCTCTCTCCCTCCTCCTCTTCGACTTCCAAAACCATCACTACCGATGACAAATCCGCTGCATCCTCCTCCACACCCGGCCCAGACATGGAAGAGCTCGAGAAGAAATGCGCTGCGTATGCCCGACATGATATGTATGGCACAATGGGACGCGGGAAGCTACCGTG...
1188 bp · LXL04_008954|LXL04_008954|OH1004|CDS
ATGGATTCGGACCTCAAAGGCCCGTCCTCAAAACCCCACTCCCAACATTGTGAATTAAATCTCGAAGAGGGTCATATTAAAGATGTTTCCCCCCTCCTCTCTCCCTCCTCCTCTTCGACTTCCAAAACCATCACTACCGATGACAAATCCGCTGCATCCTCCTCCACACCCGGCCCAGACATGGAAGAGCTCGAGAAGAAATGCGCTGCGTATGCCCGACATGATATGTATGGCACAATGGGACGCGGGAAGCTACCGTG...
Protein
Download Protein FASTA395 aa · LXL04_008954|LXL04_008954|OH1004|PROTEIN
MDSDLKGPSSKPHSQHCELNLEEGHIKDVSPLLSPSSSSTSKTITTDDKSAASSSTPGPDMEELEKKCAAYARHDMYGTMGRGKLPWTQKILLGIAVITLFPLRVVSATLVVVLYYLICRACTLFLVPNQEDEQEDYAHMGGWRRTIIYWFGRVLARSLLFVFGFYWIKETYRDQDMDSKFHNELDANNESERPGAIISNHVSHLDILYHMSTSFPSFVAKKSVSKLPLIGLISKCLGCVYVQRESKSSDFKGVSGVVND...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_008954 |
|---|---|
| TK1151 ID | TkA03G304990 |
| OH-1004 ID | LXL04_008954 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 98.400 |
| Protein coverage (%) | TK1151 88.693 / OH-1004 63.544Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_008954 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:114010701-114013169 (-) | |||||||||
| Description | Similar to LPEAT1: Lysophospholipid acyltransferase LPEAT1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000038 very long-chain fatty acid metabolic process Biological Process GO:0006644 phospholipid metabolic process Biological Process GO:0008654 phospholipid biosynthetic process Biological Process GO:0036151 phosphatidylcholine acyl-chain remodeling Biological Process GO:0043129 surfactant homeostasis Biological Process GO:0045732 positive regulation of protein catabolic process Biological Process GO:2001246 negative regulation of phosphatidylcholine biosynthetic process Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005634 nucleus Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G80950 ath:AT2G45670 dre:555969 mmu:210992 rno:361467 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01553.27Acyltransferase190-307 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_008954 | PF01553.27 | Acyltransferase | 190 | 307 | 2.8e-18 | 66.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.