LXL04_008843 | RubberDandelionOmics

Gene overview

LXL04_008843

Reference: OH-1004 Chr: Chr02 Coordinates: 110233940-110235474 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1107 bp · LXL04_008843|LXL04_008843|OH1004|cDNA

ATGGGCCGCTCATCTCTCTCATCCTTCTTCTCTTTCCTCCTCCTCTTCATCTCGGCCGTCACCGCAACCGTCGGTGATGAATCCTCGTCGGATCCGTTGATCCGTCAGGTGGTCCCGGAGGATGAGACAGCTGCCGATCCTCTCTTGAACGTGGACCACCACTTCACGCTCTTCAAGAGCAAGTTTGGGAAGACCTATGCTACTCAAGAGGAGCATGATTTCCGTAAGTCCATTTTCAAGTCCAACCTTCGACGTGCTAA...

CDS

Download CDS FASTA

1107 bp · LXL04_008843|LXL04_008843|OH1004|CDS

ATGGGCCGCTCATCTCTCTCATCCTTCTTCTCTTTCCTCCTCCTCTTCATCTCGGCCGTCACCGCAACCGTCGGTGATGAATCCTCGTCGGATCCGTTGATCCGTCAGGTGGTCCCGGAGGATGAGACAGCTGCCGATCCTCTCTTGAACGTGGACCACCACTTCACGCTCTTCAAGAGCAAGTTTGGGAAGACCTATGCTACTCAAGAGGAGCATGATTTCCGTAAGTCCATTTTCAAGTCCAACCTTCGACGTGCTAA...

Protein

Download Protein FASTA

368 aa · LXL04_008843|LXL04_008843|OH1004|PROTEIN

MGRSSLSSFFSFLLLFISAVTATVGDESSSDPLIRQVVPEDETAADPLLNVDHHFTLFKSKFGKTYATQEEHDFRKSIFKSNLRRAKRHQLLDPTAEHGVTKFSDLTPSEFRRNYLGLKKPLKFPSDANKAPILPTSDLPEDFDWREKGAVTAVKDQGSCGSCWSFSTTGALEGSHFLQTGELVSLSEQQLVDCDHECDPAERNACDAGCNGGLMNNAFEYILKAGGVQKEADYPYKGTDGTCHFDKSKIAASVSNFSVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008843`
TK1151 ID	TkA03G321330
OH-1004 ID	LXL04_008843
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008843

Location Chr02:110233940-110235474 (-)

Description Similar to Cysteine proteinase 15A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21430`	Probable thiol protease.	No verified direct reference in this release
`At4g39090`	Probable thiol protease (By similarity).	No verified direct reference in this release
`At4g16190`	Probable thiol protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008843 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010269 response to selenium ion Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0000323 lytic vacuole Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G21430

ath:AT4G16190

ath:AT4G39090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.672

Rank 1 · LXL04_008843 · OH-1004

Cytoplasm0.162

Rank 2 · LXL04_008843 · OH-1004

Extracellular0.160

Rank 3 · LXL04_008843 · OH-1004

Endoplasmic reticulum0.119

Rank 4 · LXL04_008843 · OH-1004

Cell membrane0.109

Rank 5 · LXL04_008843 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08246.18Inhibitor_I2955-111 aa

PF00112.30Peptidase_C1139-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008843	`PF08246.18`	Inhibitor_I29	55	111	3.4e-15	56.8
LXL04_008843	`PF00112.30`	Peptidase_C1	139	363	5.1e-73	246.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43295`	Arabidopsis thaliana	Probable cysteine protease RD19B	66.209%	Swiss-Prot	strong database homology
`P43296`	Arabidopsis thaliana	Cysteine protease RD19A	67.033%	Swiss-Prot	strong database homology
`Q9SUL1`	Arabidopsis thaliana	Probable cysteine protease RD19C	69.022%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card