LXL04_008720 | RubberDandelionOmics

Gene overview

LXL04_008720

Reference: OH-1004 Chr: Chr02 Coordinates: 106867221-106870141 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1659 bp · LXL04_008720|LXL04_008720|OH1004|cDNA

ATGAACGAGAAACAACGATCGATTCTCCTTCAATCCTCTACCCATTTCCCGCCGCCAAAAGGAACTAAGCTCTCTTATGGCACCGCCGGATTCAGAGCCGACGCTTCGATCCTCCAATCGACAGTATTTAGAATCGGGATACTGGCGGCATTGCGGTCGTTGAAGACTGGAGGAGCGGTGATCGGGTTGATGATCACTGCTTCACACAACAAAGTCTCTGATAATGGCATCAAAGTCGCTGACCCAAGCGGCGGAATGCT...

CDS

Download CDS FASTA

1659 bp · LXL04_008720|LXL04_008720|OH1004|CDS

ATGAACGAGAAACAACGATCGATTCTCCTTCAATCCTCTACCCATTTCCCGCCGCCAAAAGGAACTAAGCTCTCTTATGGCACCGCCGGATTCAGAGCCGACGCTTCGATCCTCCAATCGACAGTATTTAGAATCGGGATACTGGCGGCATTGCGGTCGTTGAAGACTGGAGGAGCGGTGATCGGGTTGATGATCACTGCTTCACACAACAAAGTCTCTGATAATGGCATCAAAGTCGCTGACCCAAGCGGCGGAATGCT...

Protein

Download Protein FASTA

552 aa · LXL04_008720|LXL04_008720|OH1004|PROTEIN

MNEKQRSILLQSSTHFPPPKGTKLSYGTAGFRADASILQSTVFRIGILAALRSLKTGGAVIGLMITASHNKVSDNGIKVADPSGGMLTQDWEPFADSIANAPDPESLVQLITEFAKKENIPIDGSKAAVVLLGRDTRPSGESLVEAANKGICCVIGAVAINMGIVTTPELHWMVRARNKGMKASEADYFHQLSTSFRCLIDLIPEKSGEDNDAIGKLVVDCSNGVGGEKLQDLTQKLNGFLQIEIRNSGGNSGGILNEGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008720`
TK1151 ID	TkA03G342370
OH-1004 ID	LXL04_008720
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008720

Location Chr02:106867221-106870141 (-)

Description Similar to DRT101: Phosphoacetylglucosamine mutase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18070`	Interconverts GlcNAc-6-P and GlcNAc-1-P.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0195400`	Interconverts GlcNAc-6-P and GlcNAc-1-P.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008720 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006041 glucosamine metabolic process Biological Process

GO:0006048 UDP-N-acetylglucosamine biosynthetic process Biological Process

GO:0006281 DNA repair Biological Process

GO:0006487 protein N-linked glycosylation Biological Process

GO:0006493 protein O-linked glycosylation Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G18070

dosa:Os07g0195400

hsa:5238

mmu:109785

ssc:100156015

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.792

Rank 1 · LXL04_008720 · OH-1004

Nucleus0.372

Rank 2 · LXL04_008720 · OH-1004

Mitochondrion0.081

Rank 3 · LXL04_008720 · OH-1004

Peroxisome0.060

Rank 4 · LXL04_008720 · OH-1004

Cell membrane0.037

Rank 5 · LXL04_008720 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02878.23PGM_PMM_I57-91 aa

PF02878.23PGM_PMM_I118-178 aa

PF21405.3AMG1_II183-295 aa

PF21404.4AMG1_III311-455 aa

PF02880.23PGM_PMM_III311-392 aa

PF00408.27PGM_PMM_IV489-545 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008720	`PF02878.23`	PGM_PMM_I	57	91	7.9e-16	58.7
LXL04_008720	`PF02878.23`	PGM_PMM_I	118	178	7.9e-16	58.7
LXL04_008720	`PF21405.3`	AMG1_II	183	295	1.6e-09	39.0
LXL04_008720	`PF21404.4`	AMG1_III	311	455	1.6e-52	177.7
LXL04_008720	`PF02880.23`	PGM_PMM_III	311	392	5.3e-08	33.7
LXL04_008720	`PF00408.27`	PGM_PMM_IV	489	545	9.3e-12	45.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P57750`	Arabidopsis thaliana	Phosphoacetylglucosamine mutase	65.350%	Swiss-Prot	strong database homology
`Q6ZDQ1`	Oryza sativa subsp. japonica	Phosphoacetylglucosamine mutase	58.993%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card