LXL04_008578 | RubberDandelionOmics

Gene overview

LXL04_008578

Reference: OH-1004 Chr: Chr02 Coordinates: 103107776-103113612 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3171 bp · LXL04_008578|LXL04_008578|OH1004|cDNA

ATTTGAACTTGACGATTGACCCATTGTCAAAGACTTCCTCAAAGAAACACAGAGATGAGATCTATCAGACGGCTGATAATTACTTCCAATACCACCCCAAATCGCAAGAACCCTTGAAAGCTCTACCCACGGGCGCCAAAAACCTCCCAAACATAATCACAAAAATACACATTACACACGCATACACATCTTCAAATCATTACTATAAAGATACACCAATAAAACCCTCTATCTGGATTTCAATTTGTTTGAAGTCCTAC...

CDS

Download CDS FASTA

2892 bp · LXL04_008578|LXL04_008578|OH1004|CDS

ATGGCCCTCGAGAACATTGTCAAAGAAGCATTGAACGCACTCTATCATCACCCAGATGACGCTGTTCGCTCTCAAGCCGATCAATGGCTTCAAGAGTTCCAACGGACAATCGATGCGTGGCAGGTGTCCGATAATTTGCTTCACGATGCTAGTAGCAATGTGGAAACTCTAATTTTCTGCTCACAAACTCTCAGAAGTAAGGTGCAAAGAGATTTTGAAGAATTACCCTCTGAAGCATTCCGTTCACTTCGCGATTCTTT...

Protein

Download Protein FASTA

963 aa · LXL04_008578|LXL04_008578|OH1004|PROTEIN

MALENIVKEALNALYHHPDDAVRSQADQWLQEFQRTIDAWQVSDNLLHDASSNVETLIFCSQTLRSKVQRDFEELPSEAFRSLRDSLNNLLKTFHKGPPKVRTQISLAVAALAVQVPAEDWGDGGIMNWLRDEMNLHPDIVPSFLELLRVLPEEVFNYKIAARPDRRRKFENELASTMDVSLGILTACLNIPELKEQALEAFASWLRLRHRIPASVLATHPLVLTALSSLTSDVLSEAAVNVISELIHYTSARNTDGFSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008578`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008578

Location Chr02:103107776-103113612 (-)

Description Similar to MOS14: Transportin MOS14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62600`	Functions as a nuclear import receptor for serine-arginine rich (SR) proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008578 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006403 RNA localization Biological Process

GO:0006404 RNA import into nucleus Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0035719 tRNA import into nucleus Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0051031 tRNA transport Biological Process

GO:0061015 snRNA import into nucleus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005642 annulate lamellae Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G62600

hsa:23534

mmu:320938

sce:YOR160W

spo:2539916

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.662

Rank 1 · LXL04_008578 · OH-1004

Cytoplasm0.499

Rank 2 · LXL04_008578 · OH-1004

Lysosome / Vacuole0.055

Rank 3 · LXL04_008578 · OH-1004

Cell membrane0.052

Rank 4 · LXL04_008578 · OH-1004

Golgi apparatus0.043

Rank 5 · LXL04_008578 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03810.26IBN_N26-91 aa

PF08389.19Xpo198-243 aa

PF24138.2TPR_TNPO3_IPO13_2nd285-351 aa

PF24140.2TPR_TNPO3_IPO13_3rd474-563 aa

PF24139.2TPR_TNPO3_IPO13_4th656-753 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008578	`PF03810.26`	IBN_N	26	91	9.6e-07	29.4
LXL04_008578	`PF08389.19`	Xpo1	98	243	2.5e-20	73.8
LXL04_008578	`PF24138.2`	TPR_TNPO3_IPO13_2nd	285	351	9e-17	61.9
LXL04_008578	`PF24140.2`	TPR_TNPO3_IPO13_3rd	474	563	1.5e-06	29.0
LXL04_008578	`PF24139.2`	TPR_TNPO3_IPO13_4th	656	753	3.7e-17	63.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUL2`	Arabidopsis thaliana	Transportin MOS14	69.488%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card