LXL04_008467 | RubberDandelionOmics

Gene overview

LXL04_008467

Reference: OH-1004 Chr: Chr02 Coordinates: 100364185-100369250 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1782 bp · LXL04_008467|LXL04_008467|OH1004|cDNA

ATGGTGGTGGTGTTGGCGGTCACAGATGCCGTGGTTGTGGTGGTGGTGACAGCCGTGGTGACGACAAAAGATGGTGGTGATTGTTCGGAATGGTGGGGTTTCATCGGCGCACTGAGAACAACGGCTTTGGCTGACGCCAATGGAGAGATTCAGATCCACTGTCACTATTCCTCCACATCGGCTTATGTTTACGGATTCTCCACCGACTCTGTCGCCGGAACTCACCGACGGCTTCCACATCTCCTTTTCTTCGTCCAGTC...

CDS

Download CDS FASTA

1782 bp · LXL04_008467|LXL04_008467|OH1004|CDS

ATGGTGGTGGTGTTGGCGGTCACAGATGCCGTGGTTGTGGTGGTGGTGACAGCCGTGGTGACGACAAAAGATGGTGGTGATTGTTCGGAATGGTGGGGTTTCATCGGCGCACTGAGAACAACGGCTTTGGCTGACGCCAATGGAGAGATTCAGATCCACTGTCACTATTCCTCCACATCGGCTTATGTTTACGGATTCTCCACCGACTCTGTCGCCGGAACTCACCGACGGCTTCCACATCTCCTTTTCTTCGTCCAGTC...

Protein

Download Protein FASTA

593 aa · LXL04_008467|LXL04_008467|OH1004|PROTEIN

MVVVLAVTDAVVVVVVTAVVTTKDGGDCSEWWGFIGALRTTALADANGEIQIHCHYSSTSAYVYGFSTDSVAGTHRRLPHLLFFVQSGWQVLLQTSLLHLNMRGRQRDHIHTTYKRASSKERLNAQDIEDGGGQHEFAKGSGNPPWIRSLPHVIVAALSSFLFGYHLGVVNDTLESISLDLNFHGDTMAEGLVVSTCLGGAFVGSTVSGWIADGIGRRRSFQLCSIPMIIGAAVSATSDGLGGMLLGRFLVGTSMGVCPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008467`
TK1151 ID	TkA03G369120
OH-1004 ID	LXL04_008467
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 82.968 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008467

Location Chr02:100364185-100369250 (-)

Description Similar to At1g79820: Probable plastidic glucose transporter 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79820`	May be involved in the efflux of glucose towards the cytosol.	No verified direct reference in this release
`At1g67300`	May be involved in the efflux of glucose towards the cytosol.	No verified direct reference in this release
`At5g16150`	May be involved in the efflux of glucose towards the cytosol.	No verified direct reference in this release
`At1g05030`	May be involved in the efflux of glucose towards the cytosol.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008467 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008643 carbohydrate transport Biological Process

GO:0015749 monosaccharide transmembrane transport Biological Process

GO:1904659 D-glucose transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT1G05030

ath:AT1G67300

ath:AT1G79820

ath:AT5G16150

bsu:BSU39810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.384

Rank 1 · LXL04_008467 · OH-1004

Cell membrane0.231

Rank 2 · LXL04_008467 · OH-1004

Endoplasmic reticulum0.152

Rank 3 · LXL04_008467 · OH-1004

Golgi apparatus0.146

Rank 4 · LXL04_008467 · OH-1004

Cytoplasm0.124

Rank 5 · LXL04_008467 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083.31Sugar_tr153-583 aa

PF07690.22MFS_1158-500 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008467	`PF00083.31`	Sugar_tr	153	583	1.9e-97	327.7
LXL04_008467	`PF07690.22`	MFS_1	158	500	4e-18	66.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2V4B9`	Arabidopsis thaliana	Probable plastidic glucose transporter 3	66.395%	Swiss-Prot	strong database homology
`Q9FYG3`	Arabidopsis thaliana	Probable plastidic glucose transporter 2	68.024%	Swiss-Prot	strong database homology
`Q56ZZ7`	Arabidopsis thaliana	Plastidic glucose transporter 4	43.121%	Swiss-Prot	moderate database homology
`Q0WVE9`	Arabidopsis thaliana	Probable plastidic glucose transporter 1	44.444%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card