LXL04_008401 | RubberDandelionOmics

Gene overview

LXL04_008401

Reference: OH-1004 Chr: Chr02 Coordinates: 98653069-98653794 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

639 bp · LXL04_008401|LXL04_008401|OH1004|cDNA

ATGGTTCCAACCCTATCCTTGATCTGTGTTTCCCAAACACTCAATTTCGTACCCGTAAGGAAAAATTTGAACTTCGGTTTTCATTCGTTCAAATCATCAATGGTAATGGGTGAAGGAAAAAAGCAAAGCTATAGCCATCAGAATCAAAGATGGAATGTAATGGAAGAATCAGATAAGTTTAAACATCAACAGGAAGATGATCATGATCATGATCATGAACACGAACACGAACAACCATGTTCCTCCATTGAAGAAGCTTG...

CDS

Download CDS FASTA

639 bp · LXL04_008401|LXL04_008401|OH1004|CDS

ATGGTTCCAACCCTATCCTTGATCTGTGTTTCCCAAACACTCAATTTCGTACCCGTAAGGAAAAATTTGAACTTCGGTTTTCATTCGTTCAAATCATCAATGGTAATGGGTGAAGGAAAAAAGCAAAGCTATAGCCATCAGAATCAAAGATGGAATGTAATGGAAGAATCAGATAAGTTTAAACATCAACAGGAAGATGATCATGATCATGATCATGAACACGAACACGAACAACCATGTTCCTCCATTGAAGAAGCTTG...

Protein

Download Protein FASTA

212 aa · LXL04_008401|LXL04_008401|OH1004|PROTEIN

MVPTLSLICVSQTLNFVPVRKNLNFGFHSFKSSMVMGEGKKQSYSHQNQRWNVMEESDKFKHQQEDDHDHDHEHEHEQPCSSIEEACSTISNGSSLTCSSSSSSDTTDDASSSSANSSRSSLYDLSDLMSQLPIKRGLSKFYHGKSDSFTSLARVTSIEDLPKKEPKMKKTKKKKSHRSHTLPRPIIAKKNHRCNSNKKFGGSMKKEQVHDK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008401`
TK1151 ID	TkA03G376290
OH-1004 ID	LXL04_008401
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.000
Protein coverage (%)	TK1151 81.373 / OH-1004 77.358 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008401

Location Chr02:98653069-98653794 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56550`	Promotes the tolerance to a range of metals, including cadmium (Cd), arsenic (As) and copper (Cu) and to oxidizing chemicals (e.g. diamide and tert-butyl hydroperoxide (t-BOOH)).	OXIDATIVE STRESS 3 is a chromatin-associated factor involved in tolerance to heavy metals and oxidative stress.2009 · DOI: 10.1111/j.1365-313x.2008.03717.x OXIDATIVE STRESS 3 regulates drought-induced flowering through APETALA 1.2019 · DOI: 10.1016/j.bbrc.2019.08.154

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008401 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0010114 response to red light Biological Process

GO:0010218 response to far red light Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0046688 response to copper ion Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:2000070 regulation of response to water deprivation Biological Process

GO:0005634 nucleus Cellular Component

GO:0016607 nuclear speck Cellular Component

KEGG gene cross-reference

ath:AT5G56550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.575

Rank 1 · LXL04_008401 · OH-1004

Cytoplasm0.384

Rank 2 · LXL04_008401 · OH-1004

Cell membrane0.125

Rank 3 · LXL04_008401 · OH-1004

Endoplasmic reticulum0.056

Rank 4 · LXL04_008401 · OH-1004

Mitochondrion0.040

Rank 5 · LXL04_008401 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30470.1OXS376-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008401	`PF30470.1`	OXS3	76	172	4.6e-13	50.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVB9`	Arabidopsis thaliana	Protein OXIDATIVE STRESS 3	66.102%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card