LXL04_008255 | RubberDandelionOmics

Gene overview

LXL04_008255

Reference: OH-1004 Chr: Chr02 Coordinates: 94967174-94969779 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1217 bp · LXL04_008255|LXL04_008255|OH1004|cDNA

ATTGCCAGATTAGTAATCGCTACAGGATCAATGAGGCTGTGCCAAATAGCCATAAGAGGATGCACCCAAAATACGGAAACAATGATAGATGTTGCATTGACTATAAGCTCGTTGTGCGCTTGTGGCTGAAAATTTCTCACAGGATGCCGATGAAGTTTGTGAAGACTGAAGGGGTAAACGATCGTATAGCAATGCTGAAAGCCATGGCTGAAGATCTTAAGAAGAATAGGGCAAATGTGGTTAGCAGCCTCGGGTTTTCA...

CDS

Download CDS FASTA

1158 bp · LXL04_008255|LXL04_008255|OH1004|CDS

ATGCACCCAAAATACGGAAACAATGATAGATGTTGCATTGACTATAAGCTCGTTGTGCGCTTGTGGCTGAAAATTTCTCACAGGATGCCGATGAAGTTTGTGAAGACTGAAGGGGTAAACGATCGTATAGCAATGCTGAAAGCCATGGCTGAAGATCTTAAGAAGAATAGGGCAAATGTGGTTAGCAGCCTCGGGTTTTCATCGATAAATGCTTACACTGTGCTATCCGTCAAGATCAGGGGCAAATGTGCAGTTCGTGC...

Protein

Download Protein FASTA

385 aa · LXL04_008255|LXL04_008255|OH1004|PROTEIN

MHPKYGNNDRCCIDYKLVVRLWLKISHRMPMKFVKTEGVNDRIAMLKAMAEDLKKNRANVVSSLGFSSINAYTVLSVKIRGKCAVRAYALNPRNQMARERQKWTTEEEQALFAGVEKYGQGKWKVILTDPQFASILTNRSNIDLKDKWRNIIVNRDKVKTCMSEDEVTIKSISPSDSPKPLSAVHLIDNGGTSTPSKATIDRRISPDYEAMVFEALFSTKDPNGADTNEILSFIQQRYELPDNFKRSVTLMLRRLTLSGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008255`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008255

Location Chr02:94967174-94969779 (+)

Description Similar to At1g72740: Telomere repeat-binding factor 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72740`	Binds preferentially double-stranded telomeric repeats.	No verified direct reference in this release
`At1g17520`	Binds preferentially double-stranded telomeric repeats.	No verified direct reference in this release
`At3g49850`	Binds preferentially double-stranded telomeric repeats, but it can also bind to the single G-rich telomeric strand.	Single-Myb-histone proteins from Arabidopsis thaliana: a quantitative study of telomere-binding specificity and kinetics.2009 · DOI: 10.1042/bj20082195

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008255 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006334 nucleosome assembly Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0000785 chromatin Cellular Component

GO:0000786 nucleosome Cellular Component

GO:0000791 euchromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003691 double-stranded telomeric DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G17520

ath:AT1G72740

ath:AT3G49850

zma:542123

zma:542125

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.775

Rank 1 · LXL04_008255 · OH-1004

Cytoplasm0.246

Rank 2 · LXL04_008255 · OH-1004

Cell membrane0.040

Rank 3 · LXL04_008255 · OH-1004

Mitochondrion0.030

Rank 4 · LXL04_008255 · OH-1004

Endoplasmic reticulum0.025

Rank 5 · LXL04_008255 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding100-151 aa

PF13921.13Myb_DNA-bind_6103-158 aa

PF00538.26Linker_histone206-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008255	`PF00249.38`	Myb_DNA-binding	100	151	6e-09	36.6
LXL04_008255	`PF13921.13`	Myb_DNA-bind_6	103	158	4e-08	34.0
LXL04_008255	`PF00538.26`	Linker_histone	206	265	1.1e-07	32.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IEY4`	Arabidopsis thaliana	Telomere repeat-binding factor 5	32.107%	Swiss-Prot	moderate database homology
`F4I7L1`	Arabidopsis thaliana	Telomere repeat-binding factor 4	32.154%	Swiss-Prot	moderate database homology
`Q9M2X3`	Arabidopsis thaliana	Telomere repeat-binding factor 3	36.139%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card