LXL04_008247 | RubberDandelionOmics

Gene overview

LXL04_008247

Reference: OH-1004 Chr: Chr02 Coordinates: 94767208-94789796 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

16227 bp · LXL04_008247|LXL04_008247|OH1004|cDNA

ATGGCGATTGATGGGAGTTTTTGTGTTCAATATGAGCTGGAAAGGTTTCTTTACCGGTGTCCCAAGCTCATGGCTGCTCCCCAGTTAGATAATCTAGTCAAGAAGGGGAAAGAATTGACAGAGGAAGAGTTGATTGTAGGAGTAGCTGAGTTACTTTTACATCCGCGCTATACAATCCCATTAGTGGGATGCTTTCGCCCAATTGCACGGAAAATTGTTGACCGAGTTGTTGCTTTGCTACATTTGGTGCCTGATTTGAC...

CDS

Download CDS FASTA

16227 bp · LXL04_008247|LXL04_008247|OH1004|CDS

ATGGCGATTGATGGGAGTTTTTGTGTTCAATATGAGCTGGAAAGGTTTCTTTACCGGTGTCCCAAGCTCATGGCTGCTCCCCAGTTAGATAATCTAGTCAAGAAGGGGAAAGAATTGACAGAGGAAGAGTTGATTGTAGGAGTAGCTGAGTTACTTTTACATCCGCGCTATACAATCCCATTAGTGGGATGCTTTCGCCCAATTGCACGGAAAATTGTTGACCGAGTTGTTGCTTTGCTACATTTGGTGCCTGATTTGAC...

Protein

Download Protein FASTA

5408 aa · LXL04_008247|LXL04_008247|OH1004|PROTEIN

MAIDGSFCVQYELERFLYRCPKLMAAPQLDNLVKKGKELTEEELIVGVAELLLHPRYTIPLVGCFRPIARKIVDRVVALLHLVPDLTSNSNDSMLEFDEGRLFKETETLDYEQDISVINLYARYGRGLALHELSCLAFSRTLDMLPYLSGSVRDYFKFAPPPFKRIMEKESMTQSLLQSGTQLLDAVRVSYRLLLAEPEVFARLWDWSCYMDLIHEITGINGADTELFMDIRWCTVQTLTMVLGMSDKFIRKSKTSDMVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008247`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008247

Location Chr02:94767208-94789796 (-)

Description Similar to MDN1: Midasin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67120`	Nuclear chaperone required for maturation and nuclear export of pre-60S ribosome subunits.	The MIDASIN and NOTCHLESS genes are essential for female gametophyte development in Arabidopsis thaliana.2010 · DOI: 10.1007/s12298-010-0005-y The Mutation of Glu at Amino Acid 3838 of AtMDN1 Provokes Pleiotropic Developmental Phenotypes in Arabidopsis.2016 · DOI: 10.1038/srep36446

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008247 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000027 ribosomal large subunit assembly Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0048638 regulation of developmental growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT1G67120

ddi:DDB_G0295765

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.481

Rank 1 · LXL04_008247 · OH-1004

Nucleus0.331

Rank 2 · LXL04_008247 · OH-1004

Mitochondrion0.190

Rank 3 · LXL04_008247 · OH-1004

Cell membrane0.063

Rank 4 · LXL04_008247 · OH-1004

Golgi apparatus0.058

Rank 5 · LXL04_008247 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07728.21AAA_5353-472 aa

PF07724.21AAA_2354-456 aa

PF17867.8AAA_lid_7502-606 aa

PF13191.13AAA_16656-698 aa

PF12775.14AAA_7665-706 aa

PF07728.21AAA_5671-717 aa

PF07728.21AAA_5819-906 aa

PF17865.8AAA_lid_5919-1021 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008247	`PF07728.21`	AAA_5	353	472	1.6e-117	388.5
LXL04_008247	`PF07724.21`	AAA_2	354	456	1.4e-17	65.0
LXL04_008247	`PF17867.8`	AAA_lid_7	502	606	8.2e-58	194.0
LXL04_008247	`PF13191.13`	AAA_16	656	698	5.3e-27	96.1
LXL04_008247	`PF12775.14`	AAA_7	665	706	4.5e-28	98.7
LXL04_008247	`PF07728.21`	AAA_5	671	717	1.6e-117	388.5
LXL04_008247	`PF07728.21`	AAA_5	819	906	1.6e-117	388.5
LXL04_008247	`PF17865.8`	AAA_lid_5	919	1021	9.2e-29	100.5
LXL04_008247	`PF07728.21`	AAA_5	1072	1208	1.6e-117	388.5
LXL04_008247	`PF07726.18`	AAA_3	1073	1209	3.5e-33	115.0
LXL04_008247	`PF07724.21`	AAA_2	1073	1163	1.4e-17	65.0
LXL04_008247	`PF17867.8`	AAA_lid_7	1220	1316	8.2e-58	194.0
LXL04_008247	`PF07728.21`	AAA_5	1374	1419	1.6e-117	388.5
LXL04_008247	`PF07728.21`	AAA_5	1510	1597	1.6e-117	388.5
LXL04_008247	`PF21108.4`	MDN1_4th	1673	1709	4.6e-08	33.6
LXL04_008247	`PF07728.21`	AAA_5	1820	1959	1.6e-117	388.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A1P8AUY4`	Arabidopsis thaliana	Midasin	46.117%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card