Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2748 bp · LXL04_008155|LXL04_008155|OH1004|cDNA
ATGGGTGCCGCAGAAAGCCGGGATTTGGAAATCTCTGATTCTGAATCCGAGGAAGAAGAACAGCAgtccgaagaagaagaagaggaggaggaAAATTACGAAGACGTCAAAGACCACCATTCAGCCACCAAAACCCCACCGAAAACCCCCTCATCTGTTGACGAAATTGATGCAAAGCTGAAAGCCCTAAAACTAAAATACCAATCTAAAAACCAAAACCTGAAGAACGCCGTTAAGCTTTACATTCATACCGGTGGAGA...
2748 bp · LXL04_008155|LXL04_008155|OH1004|CDS
ATGGGTGCCGCAGAAAGCCGGGATTTGGAAATCTCTGATTCTGAATCCGAGGAAGAAGAACAGCAGTCCGAAGAAGAAGAAGAGGAGGAGGAAAATTACGAAGACGTCAAAGACCACCATTCAGCCACCAAAACCCCACCGAAAACCCCCTCATCTGTTGACGAAATTGATGCAAAGCTGAAAGCCCTAAAACTAAAATACCAATCTAAAAACCAAAACCTGAAGAACGCCGTTAAGCTTTACATTCATACCGGTGGAGA...
Protein
Download Protein FASTA915 aa · LXL04_008155|LXL04_008155|OH1004|PROTEIN
MGAAESRDLEISDSESEEEEQQSEEEEEEEENYEDVKDHHSATKTPPKTPSSVDEIDAKLKALKLKYQSKNQNLKNAVKLYIHTGGDTAQSKWVVIDKISSYSFIKTTMEEDGDEEEDGDGDLYWFLKVGSKVRSPVDQQLQLKPIMDQRRIDFVSNGVYAMKFFSLEDYKVFIEQYEKCLFENTYGFECNDQNKAKVYGKDFVSWANPQAADDSMWEDAEDSFSKSPAFKTPVRTNHDLTEEFEEAAKGGSIKSLALGA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_008155 |
|---|---|
| TK1151 ID | TkA03G275810 |
| OH-1004 ID | LXL04_008155 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 95.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_008155 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:89751577-89755135 (+) | |||||||||
| Description | Similar to CYPRO4: Protein CYPRO4 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009409 response to cold Biological Process GO:0009416 response to light stimulus Biological Process GO:0009644 response to high light intensity Biological Process GO:0009645 response to low light intensity stimulus Biological Process GO:0009768 photosynthesis, light harvesting in photosystem I Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009522 photosystem I Cellular Component GO:0009523 photosystem II Cellular Component GO:0009534 chloroplast thylakoid Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G45474 ath:AT3G47470 sly:101264376 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23581.2DUF713544-200 aaPF08553.17VID27255-573 aaPF23414.2Beta-prop_EML_2357-488 aaPF00504.29Chloroa_b-bind682-836 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_008155 | PF23581.2 | DUF7135 | 44 | 200 | 5.5e-67 | 225.4 |
| LXL04_008155 | PF08553.17 | VID27 | 255 | 573 | 5e-44 | 151.5 |
| LXL04_008155 | PF23414.2 | Beta-prop_EML_2 | 357 | 488 | 8.1e-06 | 26.1 |
| LXL04_008155 | PF00504.29 | Chloroa_b-bind | 682 | 836 | 6e-42 | 144.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.