LXL04_008145 | RubberDandelionOmics

Gene overview

LXL04_008145

Reference: OH-1004 Chr: Chr02 Coordinates: 89066250-89067321 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · LXL04_008145|LXL04_008145|OH1004|cDNA

ATGCTTCCCTTATATGTCGTGTCTCACAACTACGAATCGCTTCATTGTTACTTCTTAAACTCCTCACTCTACTCCTCACTCTTATCAATGGTTTGGAAGGCGAAAAGGATGTTGAACATCGGAAGTGAACGGAGGTTGAAGAAAGCTGCCGGTCACGGCGATGAGCTCGTAAGGGACATGGTGATAAGAATTTATACCATTGCTGACAGAGCGTATGAATGTGCAAAATCCTTATGTCGCCAATTTGTGGTTGGGTGGCT...

CDS

Download CDS FASTA

366 bp · LXL04_008145|LXL04_008145|OH1004|CDS

ATGCTTCCCTTATATGTCGTGTCTCACAACTACGAATCGCTTCATTGTTACTTCTTAAACTCCTCACTCTACTCCTCACTCTTATCAATGGTTTGGAAGGCGAAAAGGATGTTGAACATCGGAAGTGAACGGAGGTTGAAGAAAGCTGCCGGTCACGGCGATGAGCTCGTAAGGGACATGGTGATAAGAATTTATACCATTGCTGACAGAGCGTATGAATGTGCAAAATCCTTATGTCGCCAATTTGTGGTTGGGTGGCT...

Protein

Download Protein FASTA

121 aa · LXL04_008145|LXL04_008145|OH1004|PROTEIN

MLPLYVVSHNYESLHCYFLNSSLYSSLLSMVWKAKRMLNIGSERRLKKAAGHGDELVRDMVIRIYTIADRAYECAKSLCRQFVVGWLTVLDSVPEIDMHDFLPDFLDGNEKGIAGKFVGLN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008145`
TK1151 ID	TkA05G364080
OH-1004 ID	LXL04_008145
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008145

Location Chr02:89066250-89067321 (-)

Description Similar to VAC14: Protein VAC14 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01690`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008145 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006661 phosphatidylinositol biosynthetic process Biological Process

GO:0007033 vacuole organization Biological Process

GO:0007165 signal transduction Biological Process

GO:0009555 pollen development Biological Process

GO:1903100 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphate metabolic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0031901 early endosome membrane Cellular Component

GO:0031902 late endosome membrane Cellular Component

KEGG gene cross-reference

ath:AT2G01690

dre:447912

gga:415678

hsa:55697

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.378

Rank 1 · LXL04_008145 · OH-1004

Nucleus0.326

Rank 2 · LXL04_008145 · OH-1004

Mitochondrion0.219

Rank 3 · LXL04_008145 · OH-1004

Cell membrane0.104

Rank 4 · LXL04_008145 · OH-1004

Endoplasmic reticulum0.075

Rank 5 · LXL04_008145 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU97`	Arabidopsis thaliana	Protein VAC14 homolog	43.750%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card