LXL04_008138 | RubberDandelionOmics

Gene overview

LXL04_008138

Reference: OH-1004 Chr: Chr02 Coordinates: 88976658-88979860 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1392 bp · LXL04_008138|LXL04_008138|OH1004|cDNA

ATGGAAGAACTTGAAAAATGTCATaactataaaaaaaacaaaattcgAAGGACGTGGGACACGTGTCGGCTACAAACCCTGACCCTTCATCTACCCCTGCAGGAAATTCTTTTGGGATTTGATTGTCCTGCGACGGGCTTGAATTCATCAATTTGGAGCATTCAGGGAAACATAATTATGAACTTCAAAAATTTAGGAAATCTGCCAATGGATAGCAGAAACGGGAGCGGCCGGCCTCCGGGCAACTTCCCGTTGGCGAG...

CDS

Download CDS FASTA

1392 bp · LXL04_008138|LXL04_008138|OH1004|CDS

ATGGAAGAACTTGAAAAATGTCATAACTATAAAAAAAACAAAATTCGAAGGACGTGGGACACGTGTCGGCTACAAACCCTGACCCTTCATCTACCCCTGCAGGAAATTCTTTTGGGATTTGATTGTCCTGCGACGGGCTTGAATTCATCAATTTGGAGCATTCAGGGAAACATAATTATGAACTTCAAAAATTTAGGAAATCTGCCAATGGATAGCAGAAACGGGAGCGGCCGGCCTCCGGGCAACTTCCCGTTGGCGAG...

Protein

Download Protein FASTA

463 aa · LXL04_008138|LXL04_008138|OH1004|PROTEIN

MEELEKCHNYKKNKIRRTWDTCRLQTLTLHLPLQEILLGFDCPATGLNSSIWSIQGNIIMNFKNLGNLPMDSRNGSGRPPGNFPLARQGSIYSLTFDELQNTMGSIGKDFGSMNMDELLKNIWNAEEMQTTGFNSSATTVQDRGANLQRQGSLTLPRTLSQKTVDEVWKDLSNNNGFGHPNLPSSQQTLGEITLEEFLVKAGVVREENQLSGKPNETGLFSDLTNSQKNTGFGPIGFPQAVGQNSTIDDHRSNQISFQSA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008138`
TK1151 ID	TkA05G364760
OH-1004 ID	LXL04_008138
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 90.716 / OH-1004 73.866 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008138

Location Chr02:88976658-88979860 (+)

Description Similar to ABF2: ABSCISIC ACID-INSENSITIVE 5-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g45249`	Involved in ABA and stress responses and acts as a positive component of glucose signal transduction.	Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions.2000 · DOI: 10.1073/pnas.190309197 AREB1 is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis.2005 · DOI: 10.1105/tpc.105.035659 Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.2006 · DOI: 10.1007/s11103-005-2418-5
`At1g49720`	Binds to the ABA-responsive element (ABRE).	No verified direct reference in this release
`At3g19290`	Functions as a transcriptional activator in the ABA-inducible expression of LTI65/RD29B (AC Q04980).	Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions.2000 · DOI: 10.1073/pnas.190309197 Arabidopsis basic leucine zipper proteins that mediate stress-responsive abscisic acid signaling.2002 · DOI: 10.1105/tpc.010362 The effect of ABRE BINDING FACTOR 4-mediated FYVE1 on salt stress tolerance in Arabidopsis.2020 · DOI: 10.1016/j.plantsci.2020.110489

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0766700`	Transcriptional activator that mediates abscisic acid (ABA) signaling.	Characterization of OsbZIP23 as a key player of the basic leucine zipper transcription factor family for conferring abscisic acid sensitivity and salinity and drought tolerance in rice.2008 · DOI: 10.1104/pp.108.128199 Feedback Regulation of ABA Signaling and Biosynthesis by a bZIP Transcription Factor Targets Drought-Resistance-Related Genes.2016 · DOI: 10.1104/pp.16.00469 OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.2016 · DOI: 10.1016/j.devcel.2016.06.011
`Os01g0859300`	May act as a transcription factor with transactivation activity observed in yeast.	A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance.2008 · DOI: 10.1007/s11103-008-9298-4 Phosphorylation-mediated regulation of a rice ABA responsive element binding factor.2011 · DOI: 10.1016/j.phytochem.2010.10.005 A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth.2012 · DOI: 10.1093/jxb/err338

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008138 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010255 glucose mediated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1900057 positive regulation of leaf senescence Biological Process

GO:1903648 positive regulation of chlorophyll catabolic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G45249

ath:AT1G49720

ath:AT3G19290

dosa:Os02g0766700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.905

Rank 1 · LXL04_008138 · OH-1004

Cytoplasm0.157

Rank 2 · LXL04_008138 · OH-1004

Cell membrane0.032

Rank 3 · LXL04_008138 · OH-1004

Endoplasmic reticulum0.022

Rank 4 · LXL04_008138 · OH-1004

Plastid0.013

Rank 5 · LXL04_008138 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M7Q4`	Arabidopsis thaliana	ABSCISIC ACID-INSENSITIVE 5-like protein 5	49.435%	Swiss-Prot	moderate database homology
`Q9M7Q5`	Arabidopsis thaliana	ABSCISIC ACID-INSENSITIVE 5-like protein 4	45.921%	Swiss-Prot	moderate database homology
`Q9M7Q2`	Arabidopsis thaliana	ABSCISIC ACID-INSENSITIVE 5-like protein 7	57.895%	Swiss-Prot	weak database homology
`Q6Z312`	Oryza sativa subsp. japonica	bZIP transcription factor 23	56.173%	Swiss-Prot	weak database homology
`Q8RZ35`	Oryza sativa subsp. japonica	bZIP transcription factor ABI5 homolog	37.037%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card