LXL04_008133 | RubberDandelionOmics

Gene overview

LXL04_008133

Reference: OH-1004 Chr: Chr02 Coordinates: 88629557-88630355 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

642 bp · LXL04_008133|LXL04_008133|OH1004|cDNA

ATGTCATGGTCTATACATGCTCCAGTACAAAAACACCAATGCACGCTTGCATTTAAATTAGAAAACGGAAGAAGAGAATTCAATAATCCTTCGAAATGTCCCTCTTCTCTTGTAAATACAAGTTCTATCAGAAGATGCCATTTAAAGGAGAAAGGTCCATCTCATAATACAAAACGAGCAATAATCCAGTATCAGCAGGTCCAGTGTACTCCCAATGGACATGAACCAGAGTTCTCAGATGAAGATGAGGAGCTTTGTCC...

CDS

Download CDS FASTA

642 bp · LXL04_008133|LXL04_008133|OH1004|CDS

ATGTCATGGTCTATACATGCTCCAGTACAAAAACACCAATGCACGCTTGCATTTAAATTAGAAAACGGAAGAAGAGAATTCAATAATCCTTCGAAATGTCCCTCTTCTCTTGTAAATACAAGTTCTATCAGAAGATGCCATTTAAAGGAGAAAGGTCCATCTCATAATACAAAACGAGCAATAATCCAGTATCAGCAGGTCCAGTGTACTCCCAATGGACATGAACCAGAGTTCTCAGATGAAGATGAGGAGCTTTGTCC...

Protein

Download Protein FASTA

213 aa · LXL04_008133|LXL04_008133|OH1004|PROTEIN

MSWSIHAPVQKHQCTLAFKLENGRREFNNPSKCPSSLVNTSSIRRCHLKEKGPSHNTKRAIIQYQQVQCTPNGHEPEFSDEDEELCPVECVREIKKDEELISVLEKAKEANSLVVVDFYRTSCGSCKYIEQGFAKLCRGAGDDEAPVIFLKHNVIDEYDEQSDIAERLRIKTVPLFHFYKNGVLLEAFPTRDKERIKAAIEKYTAPASTPQNA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008133`
TK1151 ID	TkA05G366110
OH-1004 ID	LXL04_008133
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008133

Location Chr02:88629557-88630355 (-)

Description Similar to At1g07700: Thioredoxin-like 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07700`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0567100`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008133 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009314 response to radiation Biological Process

GO:0019725 cellular homeostasis Biological Process

GO:0043388 positive regulation of DNA binding Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction Biological Process

GO:0061692 cellular detoxification of hydrogen peroxide Biological Process

GO:0071731 response to nitric oxide Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G07700

dosa:Os02g0567100

gga:396437

mmu:22166

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · LXL04_008133 · OH-1004

Mitochondrion0.032

Rank 2 · LXL04_008133 · OH-1004

Nucleus0.026

Rank 3 · LXL04_008133 · OH-1004

Cytoplasm0.020

Rank 4 · LXL04_008133 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_008133 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin108-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008133	`PF00085.27`	Thioredoxin	108	201	2.2e-11	44.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5C5`	Arabidopsis thaliana	Thioredoxin-like 4, chloroplastic	78.788%	Swiss-Prot	moderate database homology
`Q6YTI3`	Oryza sativa subsp. japonica	Thioredoxin-like 4, chloroplastic	75.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card