LXL04_007681 | RubberDandelionOmics

Gene overview

LXL04_007681

Reference: OH-1004 Chr: Chr02 Coordinates: 56044521-56046945 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

258 bp · LXL04_007681|LXL04_007681|OH1004|cDNA

ATGCAATCTGCAAAAGGAGTTTCCACCGTTCATTTTTGGGCTCCAACATTCAAGAGAGGCATCACCATTGCTAATATTGCAGATTTTGCCAAGCCACCAGAGAAACTTTCATACCGACGACGGCAATTTGATATTTTATTATTCTTTTCCAACTGTCACATCCACTGGAATTATCTGGTCTCGCTACAGCATGGTAATCACACCGTCGGTTATAACTCGACGCTCAGTGCTAAACGTGGATTCGATGCTCAGTgctaa

CDS

Download CDS FASTA

258 bp · LXL04_007681|LXL04_007681|OH1004|CDS

ATGCAATCTGCAAAAGGAGTTTCCACCGTTCATTTTTGGGCTCCAACATTCAAGAGAGGCATCACCATTGCTAATATTGCAGATTTTGCCAAGCCACCAGAGAAACTTTCATACCGACGACGGCAATTTGATATTTTATTATTCTTTTCCAACTGTCACATCCACTGGAATTATCTGGTCTCGCTACAGCATGGTAATCACACCGTCGGTTATAACTCGACGCTCAGTGCTAAACGTGGATTCGATGCTCAGTGCTAA

Protein

Download Protein FASTA

85 aa · LXL04_007681|LXL04_007681|OH1004|PROTEIN

MQSAKGVSTVHFWAPTFKRGITIANIADFAKPPEKLSYRRRQFDILLFFSNCHIHWNYLVSLQHGNHTVGYNSTLSAKRGFDAQC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007681`
TK1151 ID	TkA03G204850
OH-1004 ID	LXL04_007681
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 53.636 / OH-1004 69.412 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007681

Location Chr02:56044521-56046945 (-)

Description Similar to MPC4: Mitochondrial pyruvate carrier 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22310`	Mediates the uptake of pyruvate into mitochondria.	No verified direct reference in this release
`At4g05590`	Mediates the uptake of pyruvate into mitochondria.	NRGA1, a putative mitochondrial pyruvate carrier, mediates ABA regulation of guard cell ion channels and drought stress responses in Arabidopsis.2014 · DOI: 10.1093/mp/ssu061
`At4g14695`	Mediates the uptake of pyruvate into mitochondria.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007681 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006850 pyruvate import into mitochondria Biological Process

GO:2000070 regulation of response to water deprivation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:7770001 mitochondrial pyruvate carrier complex Cellular Component

GO:0050833 pyruvate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G05590

ath:AT4G14695

ath:AT4G22310

pon:100173880

sce:YHR162W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.345

Rank 1 · LXL04_007681 · OH-1004

Mitochondrion0.309

Rank 2 · LXL04_007681 · OH-1004

Nucleus0.225

Rank 3 · LXL04_007681 · OH-1004

Extracellular0.076

Rank 4 · LXL04_007681 · OH-1004

Cell membrane0.072

Rank 5 · LXL04_007681 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03650.20MPC2-60 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007681	`PF03650.20`	MPC	2	60	4.8e-12	46.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49636`	Arabidopsis thaliana	Mitochondrial pyruvate carrier 4	77.778%	Swiss-Prot	weak database homology
`Q8LD38`	Arabidopsis thaliana	Mitochondrial pyruvate carrier 3	72.222%	Swiss-Prot	weak database homology
`Q8L7H8`	Arabidopsis thaliana	Mitochondrial pyruvate carrier 2	69.444%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card