LXL04_007620 | RubberDandelionOmics

Gene overview

LXL04_007620

Reference: OH-1004 Chr: Chr02 Coordinates: 54344385-54346033 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1176 bp · LXL04_007620|LXL04_007620|OH1004|cDNA

ATGGCGAATTCGGGCTCTCCAAAGAAGGTCTTGATGATATGTGGCGATTACATGGAAGACGCCGAGGCGATGGTTCCATTTCAAGCATTGCAAGCTTACGGATTGTCCGTCGATGCTGTTTGCCCCGGTAAAAAATCCGGCGACATTTGTCGTACTGCTATTCATCAAGGTTCTCCTCATCAGACATATTCCGAATCCCGTGGTCACAACTTCACTCTAAATGCAACTTTTGATGAGATCGATTCAAGCACATATGATGG...

CDS

Download CDS FASTA

1176 bp · LXL04_007620|LXL04_007620|OH1004|CDS

ATGGCGAATTCGGGCTCTCCAAAGAAGGTCTTGATGATATGTGGCGATTACATGGAAGACGCCGAGGCGATGGTTCCATTTCAAGCATTGCAAGCTTACGGATTGTCCGTCGATGCTGTTTGCCCCGGTAAAAAATCCGGCGACATTTGTCGTACTGCTATTCATCAAGGTTCTCCTCATCAGACATATTCCGAATCCCGTGGTCACAACTTCACTCTAAATGCAACTTTTGATGAGATCGATTCAAGCACATATGATGG...

Protein

Download Protein FASTA

391 aa · LXL04_007620|LXL04_007620|OH1004|PROTEIN

MANSGSPKKVLMICGDYMEDAEAMVPFQALQAYGLSVDAVCPGKKSGDICRTAIHQGSPHQTYSESRGHNFTLNATFDEIDSSTYDGLIIPGGRAPEYLSMNESVLDLVKHFAKSGKPIASICHGQLILAAADVVKGRKMTAYPTVGPMLVAAGAHWVEPETMASCTIDGNMVTGAAYDGHAEYISHFIKALGGTITGSNKRILFLCGDYMEDYEVFVPFQSLEALDCHVDAVCPNKSAGDTCPTAVHDFEGDQTYSEKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007620`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007620

Location Chr02:54344385-54346033 (+)

Description Similar to DJ1D: Protein DJ-1 homolog D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02720`	Possesses glyoxalase I activity.	No verified direct reference in this release
`At2g38860`	May be involved in oxidative stress response.	No verified direct reference in this release
`At3g54600`	May be involved in oxidative stress response.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007620 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0106044 guanine deglycation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004462 lactoylglutathione lyase activity Molecular Function

GO:0008233 peptidase activity Molecular Function

GO:0019172 glyoxalase III activity Molecular Function

GO:0036524 protein deglycase activity Molecular Function

KEGG gene cross-reference

ath:AT2G38860

ath:AT3G02720

ath:AT3G54600

pab:PAB0311

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.824

Rank 1 · LXL04_007620 · OH-1004

Nucleus0.295

Rank 2 · LXL04_007620 · OH-1004

Mitochondrion0.075

Rank 3 · LXL04_007620 · OH-1004

Cell membrane0.068

Rank 4 · LXL04_007620 · OH-1004

Endoplasmic reticulum0.050

Rank 5 · LXL04_007620 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01965.31DJ-1_PfpI8-190 aa

PF01965.31DJ-1_PfpI201-382 aa

PF00117.35GATase267-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007620	`PF01965.31`	DJ-1_PfpI	8	190	1.4e-97	324.9
LXL04_007620	`PF01965.31`	DJ-1_PfpI	201	382	1.4e-97	324.9
LXL04_007620	`PF00117.35`	GATase	267	328	9.5e-11	42.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8R4`	Arabidopsis thaliana	Protein DJ-1 homolog D	75.192%	Swiss-Prot	strong database homology
`Q9ZV19`	Arabidopsis thaliana	DJ-1 protein homolog E	40.351%	Swiss-Prot	moderate database homology
`Q9M1G8`	Arabidopsis thaliana	DJ-1 protein homolog F	40.250%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card