RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_007498
Reference: OH-1004 Chr: Chr02 Coordinates: 50600615-50603662 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1324 bp · LXL04_007498|LXL04_007498|OH1004|cDNA

ATGGATTCTTTTACTTGCTCAAAGTCAACGAATTCAGATTCATCATATTTATCATATTTAACCCATTCTTCGCCGGTTCTCCCCCTTCCCACTCAACTTTCATACTACCTTTCATCGTCATCATCTCTCATAGTTCCAGAGAATGGCCGTGCAATGGCTTTTGGTGTGCCATGGACTGGTAACGCTGTTGGTCGTCGTATCTTTTCTGTGCGGCCAGTGGCCAATATTTCAAGGCACTTTCATCCAACGCATTCACACTT...

CDS

Download CDS FASTA

1182 bp · LXL04_007498|LXL04_007498|OH1004|CDS

ATGGCCGTGCAATGGCTTTTGGTGTGCCATGGACTGGTAACGCTGTTGGTCGTCGTATCTTTTCTGTGCGGCCAGTGGCCAATATTTCAAGGCACTTTCATCCAACGCATTCACACTTTCCTCACCTTCGGTGCTTTTGATTACTTCCGGCGATTCATTGAGTTTGTGTTTGGATCTAGAGGTACCAATGCACTCTATCTTACCCAATACTACTGCTGTGACCGACCTAACCCCATCTTACAGGGAATGTACTTAGCGAT...

Protein

Download Protein FASTA

393 aa · LXL04_007498|LXL04_007498|OH1004|PROTEIN

MAVQWLLVCHGLVTLLVVVSFLCGQWPIFQGTFIQRIHTFLTFGAFDYFRRFIEFVFGSRGTNALYLTQYYCCDRPNPILQGMYLAIIGGTYGLIVYTTFSYIPGVYISGYHRYTSLLAVGVGFLLFLLASFSDPGTVNSKNVSQYLSLYPYDNIIYSEKECSTCKILKPARSKHCSICDRCVARFDHHCGWMNNCIGEKNTLYFVMFLFWHFFLCVYGTVAIGLVLAGRLKEQKVVYILTAYYGIENSYRGLTPHVVQW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_007498
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_007498
LocationChr02:50600615-50603662 (-)
DescriptionSimilar to PAT17: Probable protein S-acyltransferase 17
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g04970 Palmitoyl acyltransferase. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0363900 Palmitoyltransferase involved in the positive regulation of salt and oxidative stress tolerance.
The zinc finger protein DHHC09 S-acylates the kinase STRK1 to regulate H2O2 homeostasis and promote salt tolerance in rice.2024 · DOI: 10.1093/plcell/koae001
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_007498 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006612 protein targeting to membrane Biological Process
GO:1901002 positive regulation of response to salt stress Biological Process
GO:1902884 positive regulation of response to oxidative stress Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005576 extracellular region Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0012505 endomembrane system Cellular Component
GO:0030659 cytoplasmic vesicle membrane Cellular Component
GO:0019706 protein-cysteine S-palmitoyltransferase activity Molecular Function
KEGG gene cross-reference
ath:AT3G04970
dre:561817
ncr:NCU04080
osa:4332904
spo:2539719
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.459
Rank 1 · LXL04_007498 · OH-1004
Golgi apparatus0.376
Rank 2 · LXL04_007498 · OH-1004
Cytoplasm0.141
Rank 3 · LXL04_007498 · OH-1004
Cell membrane0.089
Rank 4 · LXL04_007498 · OH-1004
Nucleus0.089
Rank 5 · LXL04_007498 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01529.26DHHC158-306 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_007498PF01529.26DHHC1583061.5e-35122.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q3EBC2Arabidopsis thalianaProbable protein S-acyltransferase 1765.803%Swiss-Protstrong database homology
Q10L01Oryza sativa subsp. japonicaProtein S-acyltransferase DHHC965.729%Swiss-Protstrong database homology

JBrowse

View in Genome Browser