Gene Card
Gene overview
cDNA / CDS / Protein Sequences
243 bp · LXL04_007416|LXL04_007416|OH1004|cDNA
ATGGAGTCAGGATCCGTACTTGATCGAGCTAATTGCAGAGCAAAAGGAGGTGAACCCAGATTCAAAGTCGCTATTCTAGGAGCTACTGGAGGAATCGGTCAACCTCAATCCCGAAGACAGATCAGTTGTCGGTTTGATTTTGGAGAAAGGAATGAACCAAAAGAAGAGGAAccatatgcaaaaattaaatTCTCATTTTCGGAAAACAACATAGATTGCCAGAGAAAGAATAATCCTATTTGA
243 bp · LXL04_007416|LXL04_007416|OH1004|CDS
ATGGAGTCAGGATCCGTACTTGATCGAGCTAATTGCAGAGCAAAAGGAGGTGAACCCAGATTCAAAGTCGCTATTCTAGGAGCTACTGGAGGAATCGGTCAACCTCAATCCCGAAGACAGATCAGTTGTCGGTTTGATTTTGGAGAAAGGAATGAACCAAAAGAAGAGGAACCATATGCAAAAATTAAATTCTCATTTTCGGAAAACAACATAGATTGCCAGAGAAAGAATAATCCTATTTGA
Protein
Download Protein FASTA80 aa · LXL04_007416|LXL04_007416|OH1004|PROTEIN
MESGSVLDRANCRAKGGEPRFKVAILGATGGIGQPQSRRQISCRFDFGERNEPKEEEPYAKIKFSFSENNIDCQRKNNPI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_007416 |
|---|---|
| TK1151 ID | TkA03G167950 |
| OH-1004 ID | LXL04_007416 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 95.000 |
| Protein coverage (%) | TK1151 62.992 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_007416 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:47268013-47268255 (+) | ||||||||||||
| Description | Similar to MDHG: Malate dehydrogenase, glyoxysomal | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006097 glyoxylate cycle Biological Process GO:0006099 tricarboxylic acid cycle Biological Process GO:0006108 malate metabolic process Biological Process GO:0031998 regulation of fatty acid beta-oxidation Biological Process GO:0080093 regulation of photorespiration Biological Process GO:0005737 cytoplasm Cellular Component GO:0005777 peroxisome Cellular Component GO:0009507 chloroplast Cellular Component GO:0009514 glyoxysome Cellular Component GO:0030060 L-malate dehydrogenase (NAD+) activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT2G22780 bna:106382950 csv:101219252 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.