Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1758 bp · LXL04_007379|LXL04_007379|OH1004|cDNA
ATGTCCCCCTCCTCGTCTTCACCCTATTACCGATGGGAATACGACGTGTTCTTAAATTTTAGAGGGCCCGACACTCGTAAGATCTTCGTTTCTCATCTCTATGCTGCACTCATCGGTCAAAAATTCAAAGTTTTTAAAGATGAGAAGACAATCCGAATTGGAAGAAACATTTTTTCATCTCTTTCCAAAGCCATAGAGGAATCAAGAATCTCGGTCGTTGTTTTATCCAAAAACTATGGAGAGTCCGTTAACTGCTTAAC...
1758 bp · LXL04_007379|LXL04_007379|OH1004|CDS
ATGTCCCCCTCCTCGTCTTCACCCTATTACCGATGGGAATACGACGTGTTCTTAAATTTTAGAGGGCCCGACACTCGTAAGATCTTCGTTTCTCATCTCTATGCTGCACTCATCGGTCAAAAATTCAAAGTTTTTAAAGATGAGAAGACAATCCGAATTGGAAGAAACATTTTTTCATCTCTTTCCAAAGCCATAGAGGAATCAAGAATCTCGGTCGTTGTTTTATCCAAAAACTATGGAGAGTCCGTTAACTGCTTAAC...
Protein
Download Protein FASTA585 aa · LXL04_007379|LXL04_007379|OH1004|PROTEIN
MSPSSSSPYYRWEYDVFLNFRGPDTRKIFVSHLYAALIGQKFKVFKDEKTIRIGRNIFSSLSKAIEESRISVVVLSKNYGESVNCLTELEKIFECSRSMGRCVIPVFYHVTPAEIKGQSGCFGDGFAVHGNHMKLSVWRNALIEATNIAGIEVHGNESDCITKIVETVMRELGPRRFPLSSLLPKASVYWCSLNFLTANRHTGVRQVGTARIESNSPRKKPTEVYEPLYKSVHIGRVNKEVVAIKEFNASAMKESDSTFL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_007379 |
|---|---|
| TK1151 ID | TkA03G159140 |
| OH-1004 ID | LXL04_007379 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 79.487Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_007379 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:46122767-46127964 (-) | |||||||||
| Description | Similar to RUN1: Disease resistance protein RUN1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0007165 signal transduction Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0009860 pollen tube growth Biological Process GO:0010375 stomatal complex patterning Biological Process GO:0019677 NAD+ catabolic process Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0043068 positive regulation of programmed cell death Biological Process GO:0048768 root hair cell tip growth Biological Process GO:0050832 defense response to fungus Biological Process GO:1901653 cellular response to peptide Biological Process GO:2000037 regulation of stomatal complex patterning Biological Process GO:2000038 regulation of stomatal complex development Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G41970 ath:AT3G59350 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01582.26TIR14-173 aaPF13676.12TIR_216-110 aaPF07714.24PK_Tyr_Ser-Thr223-457 aaPF00069.32Pkinase237-455 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_007379 | PF01582.26 | TIR | 14 | 173 | 3.4e-41 | 141.7 |
| LXL04_007379 | PF13676.12 | TIR_2 | 16 | 110 | 4.1e-14 | 53.8 |
| LXL04_007379 | PF07714.24 | PK_Tyr_Ser-Thr | 223 | 457 | 2.4e-24 | 86.7 |
| LXL04_007379 | PF00069.32 | Pkinase | 237 | 455 | 5.1e-19 | 69.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.