LXL04_007293 | RubberDandelionOmics

Gene overview

LXL04_007293

Reference: OH-1004 Chr: Chr02 Coordinates: 42981419-42982825 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1407 bp · LXL04_007293|LXL04_007293|OH1004|cDNA

ATGCTACTGATGCACACCCTTCCCAAACTAAGATGTCTATCTCTGTTACAACATTGCAAATCATCATCACCAACAAACCATATCACGCAAATTCACTCTCAAATCATATCCAACGGCCTCACACAATCACCCTCCATCGCTGCCCAATTGATCGAACGTTACTGTGCATCATCTGCTCCATATAGCACCAATTACGCCCGCCTCATCGTCACCCAATTCTACCGTCACGACGATAAACGCAATCCATATCTCTTGAATGT...

CDS

Download CDS FASTA

1407 bp · LXL04_007293|LXL04_007293|OH1004|CDS

ATGCTACTGATGCACACCCTTCCCAAACTAAGATGTCTATCTCTGTTACAACATTGCAAATCATCATCACCAACAAACCATATCACGCAAATTCACTCTCAAATCATATCCAACGGCCTCACACAATCACCCTCCATCGCTGCCCAATTGATCGAACGTTACTGTGCATCATCTGCTCCATATAGCACCAATTACGCCCGCCTCATCGTCACCCAATTCTACCGTCACGACGATAAACGCAATCCATATCTCTTGAATGT...

Protein

Download Protein FASTA

468 aa · LXL04_007293|LXL04_007293|OH1004|PROTEIN

MLLMHTLPKLRCLSLLQHCKSSSPTNHITQIHSQIISNGLTQSPSIAAQLIERYCASSAPYSTNYARLIVTQFYRHDDKRNPYLLNVLIRCAPPSDSILVFADWVSKTILNFDDFTYIFVLGACARRARTLREGIQIHSRVIKHGFLSNIMLQTTLIHFYVNQYAFPLAKKVFDEMHVRTPATWNSLISGYCSKAEHSRDGLLLFMDMLSGNCGVNINPNDTTMVCILSAVSRLGSLKTGATIHSYITKTIPNIENDVYI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007293`
TK1151 ID	TkAUNG066840
OH-1004 ID	LXL04_007293
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 99.359 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007293

Location Chr02:42981419-42982825 (-)

Description Similar to PCMP-E93: Pentatricopeptide repeat-containing protein At3g18970

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18970`	Pentatricopeptide repeat-containing protein At3g18970.	No verified direct reference in this release
`At3g47530`	Pentatricopeptide repeat-containing protein At3g47530.	No verified direct reference in this release
`At1g31920`	Pentatricopeptide repeat-containing protein At1g31920.	No verified direct reference in this release
`At5g43790`	Pentatricopeptide repeat-containing protein At5g43790.	No verified direct reference in this release
`At1g74630`	Pentatricopeptide repeat-containing protein At1g74630.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007293 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009451 RNA modification Biological Process

GO:0080156 mitochondrial mRNA modification Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G31920

ath:AT1G74630

ath:AT3G18970

ath:AT3G47530

ath:AT5G43790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.657

Rank 1 · LXL04_007293 · OH-1004

Plastid0.146

Rank 2 · LXL04_007293 · OH-1004

Nucleus0.050

Rank 3 · LXL04_007293 · OH-1004

Cytoplasm0.032

Rank 4 · LXL04_007293 · OH-1004

Cell membrane0.005

Rank 5 · LXL04_007293 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041.13PPR_2182-230 aa

PF13041.13PPR_2287-335 aa

PF13812.13PPR_3288-334 aa

PF01535.27PPR291-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007293	`PF13041.13`	PPR_2	182	230	7.6e-26	90.7
LXL04_007293	`PF13041.13`	PPR_2	287	335	7.6e-26	90.7
LXL04_007293	`PF13812.13`	PPR_3	288	334	6.1e-12	46.2
LXL04_007293	`PF01535.27`	PPR	291	320	2.2e-26	90.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJ69`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At3g18970	42.857%	Swiss-Prot	moderate database homology
`Q9SN85`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At3g47530	33.554%	Swiss-Prot	moderate database homology
`Q9C6T2`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At1g31920	34.783%	Swiss-Prot	moderate database homology
`Q9FG85`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At5g43790	34.461%	Swiss-Prot	moderate database homology
`Q9CA54`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At1g74630	31.660%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card