LXL04_007249 | RubberDandelionOmics

Gene overview

LXL04_007249

Reference: OH-1004 Chr: Chr02 Coordinates: 41006256-41010491 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2538 bp · LXL04_007249|LXL04_007249|OH1004|cDNA

ATGAGAACTCGAAAATCAGACAATCCCAAATCGCCCCCTGCGCCAAAAAGAACCCCACCGGCCAGAAAATCGGCAACTAAAACCCCTCCCACGCGACCACTCCATGCCTCCCAGCAATCACCATCCACGGTTACTCCTAAGCGTGACTCCGTCACTAGAGGGAAGACCGTGGTGACGAACGATACTCCAGCAACGACTCCAGAAACGCCAGGTACAACTACTCGAACCTCAAACTTTGGTTCATGTGTACCTTGTCCTTA...

CDS

Download CDS FASTA

2538 bp · LXL04_007249|LXL04_007249|OH1004|CDS

ATGAGAACTCGAAAATCAGACAATCCCAAATCGCCCCCTGCGCCAAAAAGAACCCCACCGGCCAGAAAATCGGCAACTAAAACCCCTCCCACGCGACCACTCCATGCCTCCCAGCAATCACCATCCACGGTTACTCCTAAGCGTGACTCCGTCACTAGAGGGAAGACCGTGGTGACGAACGATACTCCAGCAACGACTCCAGAAACGCCAGGTACAACTACTCGAACCTCAAACTTTGGTTCATGTGTACCTTGTCCTTA...

Protein

Download Protein FASTA

845 aa · LXL04_007249|LXL04_007249|OH1004|PROTEIN

MRTRKSDNPKSPPAPKRTPPARKSATKTPPTRPLHASQQSPSTVTPKRDSVTRGKTVVTNDTPATTPETPGTTTRTSNFGSCVPCPYFSVFKSQFLSRMKVSLSLMQVLSSCDVMHAVSVIKPQVDTVKATPRAIRTVKRVVKKTVIRKKPKLADSVAVKKEDTELLTEKDSFDEVKDMGLENQQETSPIDAKNSVKEEEEDDDVCMPLKEDEDTMKENKETIDEKSLKIQEPFIEAKIEEEPEEEPEEEQLIDNQEIIM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007249`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007249

Location Chr02:41006256-41010491 (-)

Description Similar to LIF2: Heterogeneous nuclear ribonucleoprotein Q

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00830`	Transcriptional activator that binds DNA on GAGA-like motif and 5'-(C/G)ACGTG(G/T)C(A/G)-3' consensus motif in the promoters of target genes.	Control of flowering and cell fate by LIF2, an RNA binding partner of the polycomb complex component LHP1.2011 · DOI: 10.1371/journal.pone.0016592 The hnRNP-Q protein LIF2 participates in the plant immune response.2014 · DOI: 10.1371/journal.pone.0099343 The Arabidopsis hnRNP-Q Protein LIF2 and the PRC1 Subunit LHP1 Function in Concert to Regulate the Transcription of Stress-Responsive Genes.2016 · DOI: 10.1105/tpc.16.00244

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007249 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006396 RNA processing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010439 regulation of glucosinolate biosynthetic process Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0016556 mRNA modification Biological Process

GO:0017148 negative regulation of translation Biological Process

KEGG gene cross-reference

ath:AT4G00830

hsa:10236

hsa:10492

mmu:56403

rno:363113

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.928

Rank 1 · LXL04_007249 · OH-1004

Cytoplasm0.172

Rank 2 · LXL04_007249 · OH-1004

Cell membrane0.026

Rank 3 · LXL04_007249 · OH-1004

Mitochondrion0.017

Rank 4 · LXL04_007249 · OH-1004

Endoplasmic reticulum0.014

Rank 5 · LXL04_007249 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_1415-483 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007249	`PF00076.29`	RRM_1	415	483	1.6e-24	86.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASP6`	Arabidopsis thaliana	Heterogeneous nuclear ribonucleoprotein Q	31.765%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card