LXL04_007213 | RubberDandelionOmics

Gene overview

LXL04_007213

Reference: OH-1004 Chr: Chr02 Coordinates: 39680623-39682467 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

550 bp · LXL04_007213|LXL04_007213|OH1004|cDNA

ATGCCTCCGGTCTACACCTACATAGGTAGTGCCCTTCCCCATATCTCCGCCCTTCTCCGCCGCTATGACCGGTTCCTCCGTTTCCTCTCGCAAGGTTCTAAGCAAAATTGCAACCAACAGACTTCAAAAGGAGCTGACGGAGTGGCAGATCAATCCTCCCTCTGGATTTACGCACAGAGTCACCGACAATCTTCAACGGTGGGTGATTGAAGTGAATGGAGCTCAGGGAACTATTTATGCTAACGAAAAGTACCAACTCC...

CDS

Download CDS FASTA

486 bp · LXL04_007213|LXL04_007213|OH1004|CDS

ATGACCGGTTCCTCCGTTTCCTCTCGCAAGGTTCTAAGCAAAATTGCAACCAACAGACTTCAAAAGGAGCTGACGGAGTGGCAGATCAATCCTCCCTCTGGATTTACGCACAGAGTCACCGACAATCTTCAACGGTGGGTGATTGAAGTGAATGGAGCTCAGGGAACTATTTATGCTAACGAAAAGTACCAACTCCAGGTCGATTTTCCTGAGAATTATCCCATGGAAGCTCCTCAGGTGATTTTTTTGCATCCTGCTCC...

Protein

Download Protein FASTA

161 aa · LXL04_007213|LXL04_007213|OH1004|PROTEIN

MTGSSVSSRKVLSKIATNRLQKELTEWQINPPSGFTHRVTDNLQRWVIEVNGAQGTIYANEKYQLQVDFPENYPMEAPQVIFLHPAPLHPHIYSNGHICLDILYDSWSPAMTVGSICISILSMLSSSPAKERPEDNDRYVKNCRNGRSPKETRWWFHDDKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007213`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007213

Location Chr02:39680623-39682467 (-)

Description Similar to UBC16: Probable ubiquitin-conjugating enzyme E2 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75440`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At5g42990`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At1g45050`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	Functional expression and molecular characterization of AtUBC2-1, a novel ubiquitin-conjugating enzyme (E2) from Arabidopsis thaliana.1993 · DOI: 10.1007/bf00029013
`At4g36410`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007213 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0061631 ubiquitin conjugating enzyme activity Molecular Function

KEGG gene cross-reference

ath:AT1G45050

ath:AT1G75440

ath:AT4G36410

ath:AT5G42990

ddi:DDB_G0268938

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.568

Rank 1 · LXL04_007213 · OH-1004

Nucleus0.560

Rank 2 · LXL04_007213 · OH-1004

Cell membrane0.077

Rank 3 · LXL04_007213 · OH-1004

Endoplasmic reticulum0.071

Rank 4 · LXL04_007213 · OH-1004

Mitochondrion0.061

Rank 5 · LXL04_007213 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179.32UQ_con19-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007213	`PF00179.32`	UQ_con	19	154	8.1e-39	133.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FWT2`	Arabidopsis thaliana	Probable ubiquitin-conjugating enzyme E2 16	84.472%	Swiss-Prot	strong database homology
`Q9FMM0`	Arabidopsis thaliana	Probable ubiquitin-conjugating enzyme E2 18	83.851%	Swiss-Prot	strong database homology
`P42743`	Arabidopsis thaliana	Ubiquitin-conjugating enzyme 15	82.609%	Swiss-Prot	strong database homology
`O23239`	Arabidopsis thaliana	Probable ubiquitin-conjugating enzyme E2 17	78.882%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card