LXL04_007207 | RubberDandelionOmics

Gene overview

LXL04_007207

Reference: OH-1004 Chr: Chr02 Coordinates: 39584291-39587669 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1209 bp · LXL04_007207|LXL04_007207|OH1004|cDNA

ATGCCATCGACTGGATCATCGTGGTTGAGAGGGGAATTTGCTGCTGCTAATGCAATTATTGATTCATTCTGTCATCATTTGAAGGCTGTTGGTGAACcaggggaagaagaagaaataaGTCGTGTGTCTaccaagaagaagaaagaagggGAAGGAAAATACCGGCTACCTCCTTGCAACCTCCAGGATTCCACTGTCTTGAGTAAAATCCTAAAAATGGCTCACTCATCAGGCATGACGACGGCCATGGTGTTGTTCAT...

CDS

Download CDS FASTA

1209 bp · LXL04_007207|LXL04_007207|OH1004|CDS

ATGCCATCGACTGGATCATCGTGGTTGAGAGGGGAATTTGCTGCTGCTAATGCAATTATTGATTCATTCTGTCATCATTTGAAGGCTGTTGGTGAACCAGGGGAAGAAGAAGAAATAAGTCGTGTGTCTACCAAGAAGAAGAAAGAAGGGGAAGGAAAATACCGGCTACCTCCTTGCAACCTCCAGGATTCCACTGTCTTGAGTAAAATCCTAAAAATGGCTCACTCATCAGGCATGACGACGGCCATGGTGTTGTTCAT...

Protein

Download Protein FASTA

402 aa · LXL04_007207|LXL04_007207|OH1004|PROTEIN

MPSTGSSWLRGEFAAANAIIDSFCHHLKAVGEPGEEEEISRVSTKKKKEGEGKYRLPPCNLQDSTVLSKILKMAHSSGMTTAMVLFMALTPLCFSKITNGGYLYPQFYYQSCPQATNIVRSIVARAVAQEPRMAASLLRLHFHDCFVKGCDASILLDDGGSRNIISEKGSGPNRDSVRGFEIVDEIKAALETACPQIVSCADILALAARDSTALSGGPNWEVPLGRRDSFGASLHGSNHNIPAPNNTFQTILTKFKLKGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007207`
TK1151 ID	TkA03G137600
OH-1004 ID	LXL04_007207
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 82.090 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007207

Location Chr02:39584291-39587669 (-)

Description Similar to PER72: Peroxidase 72

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66390`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At4g36430`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At2g18150`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At3g50990`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At1g44970`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007207 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0044347 cell wall polysaccharide catabolic process Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:0051707 response to other organism Biological Process

GO:0080001 mucilage extrusion from seed coat Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0004601 peroxidase activity Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ath:AT1G44970

ath:AT2G18150

ath:AT3G50990

ath:AT4G36430

ath:AT5G66390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.244

Rank 1 · LXL04_007207 · OH-1004

Extracellular0.194

Rank 2 · LXL04_007207 · OH-1004

Cell membrane0.153

Rank 3 · LXL04_007207 · OH-1004

Cytoplasm0.146

Rank 4 · LXL04_007207 · OH-1004

Endoplasmic reticulum0.116

Rank 5 · LXL04_007207 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27981.1ALKBH10B_N7-36 aa

PF00141.29peroxidase119-365 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007207	`PF27981.1`	ALKBH10B_N	7	36	1.1e-10	42.5
LXL04_007207	`PF00141.29`	peroxidase	119	365	2.1e-83	280.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJZ9`	Arabidopsis thaliana	Peroxidase 72	65.373%	Swiss-Prot	strong database homology
`O23237`	Arabidopsis thaliana	Peroxidase 49	61.755%	Swiss-Prot	strong database homology
`Q9SI16`	Arabidopsis thaliana	Peroxidase 15	59.587%	Swiss-Prot	strong database homology
`Q9SD46`	Arabidopsis thaliana	Peroxidase 36	59.880%	Swiss-Prot	strong database homology
`Q96512`	Arabidopsis thaliana	Peroxidase 9	63.487%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card