LXL04_007177 | RubberDandelionOmics

Gene overview

LXL04_007177

Reference: OH-1004 Chr: Chr02 Coordinates: 38210712-38213162 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1422 bp · LXL04_007177|LXL04_007177|OH1004|cDNA

ATGAGGGTCTTCCTCCTCTATAATTCACCATCCTCTTCATTCTCAATACCACCACCAACACCACCACCTACAACCACCACTCACCGCCCTCAAAAGCCCCTAAAACCATCTTTCATCCGTTCACTAACTGCAACTGCCCTCTCTTTTAATCTCCTCTTCTTCTCACCACTCTCTCCTCTCCCTCCTCTTTCAATTGCTTCCGATTTCAGTCCTTCAAGTTCACAATTGGAGTGTCGTGAAGAAGATCAATTTATTGAAGA...

CDS

Download CDS FASTA

1422 bp · LXL04_007177|LXL04_007177|OH1004|CDS

ATGAGGGTCTTCCTCCTCTATAATTCACCATCCTCTTCATTCTCAATACCACCACCAACACCACCACCTACAACCACCACTCACCGCCCTCAAAAGCCCCTAAAACCATCTTTCATCCGTTCACTAACTGCAACTGCCCTCTCTTTTAATCTCCTCTTCTTCTCACCACTCTCTCCTCTCCCTCCTCTTTCAATTGCTTCCGATTTCAGTCCTTCAAGTTCACAATTGGAGTGTCGTGAAGAAGATCAATTTATTGAAGA...

Protein

Download Protein FASTA

473 aa · LXL04_007177|LXL04_007177|OH1004|PROTEIN

MRVFLLYNSPSSSFSIPPPTPPPTTTTHRPQKPLKPSFIRSLTATALSFNLLFFSPLSPLPPLSIASDFSPSSSQLECREEDQFIEEERAPELVTNEELVKEAWEVVNDSYLDTGRNQWSPESWLQKKEDIIGTYLPSRSKAHDVIRKMLSTLHDPYTRFLSPSELSKMGRYDMSGIGVNLREIPDENGEVKLKVLGLILDGPAYVAGVRQGDELLSVNGVDIKGKSSFEALTLLQGPTDTSVNITVKHGNCGPIKSVDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007177`
TK1151 ID	TkA03G130660
OH-1004 ID	LXL04_007177
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007177

Location Chr02:38210712-38213162 (+)

Description Similar to CTPA1: Carboxyl-terminal-processing peptidase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46390`	Protease involved in the C-terminal processing of the chloroplastic D1 protein of photosystem II.	No verified direct reference in this release
`At4g17740`	Protease involved in the C-terminal processing of the chloroplastic D1 protein of photosystem II.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007177 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0007165 signal transduction Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004252 serine-type endopeptidase activity Molecular Function

GO:0008233 peptidase activity Molecular Function

KEGG gene cross-reference

ag:AAC49799

ath:AT4G17740

ath:AT5G46390

syn:slr0008

syp:SYNPCC7002_A0843

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.978

Rank 1 · LXL04_007177 · OH-1004

Mitochondrion0.027

Rank 2 · LXL04_007177 · OH-1004

Cytoplasm0.018

Rank 3 · LXL04_007177 · OH-1004

Peroxisome0.015

Rank 4 · LXL04_007177 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_007177 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00595.30PDZ174-247 aa

PF13180.13PDZ_2177-251 aa

PF17820.8PDZ_6201-248 aa

PF03572.24Peptidase_S41284-450 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007177	`PF00595.30`	PDZ	174	247	3.3e-06	28.1
LXL04_007177	`PF13180.13`	PDZ_2	177	251	4.4e-06	27.6
LXL04_007177	`PF17820.8`	PDZ_6	201	248	3.8e-09	36.8
LXL04_007177	`PF03572.24`	Peptidase_S41	284	450	1.7e-46	158.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KHG6`	Arabidopsis thaliana	Carboxyl-terminal-processing peptidase 1, chloroplastic	59.838%	Swiss-Prot	strong database homology
`O23614`	Arabidopsis thaliana	Carboxyl-terminal-processing peptidase 2, chloroplastic	35.544%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card