LXL04_007092 | RubberDandelionOmics

Gene overview

LXL04_007092

Reference: OH-1004 Chr: Chr02 Coordinates: 35835459-35844459 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1560 bp · LXL04_007092|LXL04_007092|OH1004|cDNA

atgggtgcaggtggtgcaccgacggtggtccggcggtggtccggtaGTGGTCCGGCGGTGGGTGCACAGCCGGTGGTCCGACtgtggtccggcggtggtccagcggtggtccggtggtgggtgcacagccggtggtccggtggtggtccggcggtggtccggtggtgggtaAACAGccggtggtccgacggtggtccggcggtggtccagcggtggtccggtggtggtccgacggtggtccggtggtgggtgcacagccg...

CDS

Download CDS FASTA

1560 bp · LXL04_007092|LXL04_007092|OH1004|CDS

ATGGGTGCAGGTGGTGCACCGACGGTGGTCCGGCGGTGGTCCGGTAGTGGTCCGGCGGTGGGTGCACAGCCGGTGGTCCGACTGTGGTCCGGCGGTGGTCCAGCGGTGGTCCGGTGGTGGGTGCACAGCCGGTGGTCCGGTGGTGGTCCGGCGGTGGTCCGGTGGTGGGTAAACAGCCGGTGGTCCGACGGTGGTCCGGCGGTGGTCCAGCGGTGGTCCGGTGGTGGTCCGACGGTGGTCCGGTGGTGGGTGCACAGCCG...

Protein

Download Protein FASTA

519 aa · LXL04_007092|LXL04_007092|OH1004|PROTEIN

MGAGGAPTVVRRWSGSGPAVGAQPVVRLWSGGGPAVVRWWVHSRWSGGGPAVVRWWVNSRWSDGGPAVVQRWSGGGPTVVRWWVHSRWSDGGPAVVRQWSSGGPVVVRRWSGGGCTAGGPTVVRRWSSGGPVVVRRWSGGGCTAGGPTVVRWWSGGGCTADGPTVVRWWVHSRWSGGGPAVVRWWVNRRWSGGGLAVVRWWSDGGPVVGAQPVVRRWSGGGPAVVQRWSGGGPAVVRWWVHSRWSDGGPAVVRWWSGGGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007092`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007092

Location Chr02:35835459-35844459 (-)

Description Similar to HPT1: Probable homogentisate phytyltransferase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18950`	Involved in the synthesis of tocopherol (vitamin E).	Isolation and characterization of homogentisate phytyltransferase genes from Synechocystis sp. PCC 6803 and Arabidopsis.2002 · DOI: 10.1104/pp.010747 Homogentisate phytyltransferase activity is limiting for tocopherol biosynthesis in Arabidopsis.2003 · DOI: 10.1104/pp.015222 Seed-specific overexpression of antioxidant genes in Arabidopsis enhances oxidative stress tolerance during germination and early seedling growth.2010 · DOI: 10.1111/j.1467-7652.2010.00509.x Vitamin E biosynthesis: functional characterization of the monocot homogentisate geranylgeranyl transferase.2011 · DOI: 10.1111/j.1365-313x.2010.04417.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0658900`	Involved in the synthesis of tocopherol (vitamin E).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007092 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006636 unsaturated fatty acid biosynthetic process Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009915 phloem sucrose loading Biological Process

GO:0010189 vitamin E biosynthetic process Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0042362 fat-soluble vitamin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0004659 prenyltransferase activity Molecular Function

GO:0010176 homogentisate phytyltransferase activity Molecular Function

KEGG gene cross-reference

ag:BAG12671

ath:AT2G18950

dosa:Os06g0658900

gmx:100301896

osa:4341727

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.361

Rank 1 · LXL04_007092 · OH-1004

Cytoplasm0.202

Rank 2 · LXL04_007092 · OH-1004

Nucleus0.124

Rank 3 · LXL04_007092 · OH-1004

Lysosome / Vacuole0.110

Rank 4 · LXL04_007092 · OH-1004

Cell membrane0.086

Rank 5 · LXL04_007092 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01040.24UbiA365-424 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007092	`PF01040.24`	UbiA	365	424	5e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VWJ1`	Arabidopsis thaliana	Homogentisate phytyltransferase 1, chloroplastic	39.669%	Swiss-Prot	weak database homology
`B7FA90`	Oryza sativa subsp. japonica	Probable homogentisate phytyltransferase 1, chloroplastic	39.669%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card