LXL04_007061 | RubberDandelionOmics

Gene overview

LXL04_007061

Reference: OH-1004 Chr: Chr02 Coordinates: 34931289-34931843 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · LXL04_007061|LXL04_007061|OH1004|cDNA

ATGGGAGAAATCATAAGAATGGCTTTGATTCTCGTGGCGGTGATGTTGATGCTAGTGGTGGATGCGGCTCCCAAAGAAGGTCGCATTTACAACAACGTTTCTCCTGAAAGACGTCAAATTTTGGCCAATGACCTTGGAGATACTCCACCCATGGGGTGTAATAGTTGGAATCACTTTGGCTGCAACAATAATGAATCCATAATTCAAGCACCTGTTGATGTTATTCTTTCAACTAGTCTCGCTAAACTTAGATACAAGTA...

CDS

Download CDS FASTA

555 bp · LXL04_007061|LXL04_007061|OH1004|CDS

ATGGGAGAAATCATAAGAATGGCTTTGATTCTCGTGGCGGTGATGTTGATGCTAGTGGTGGATGCGGCTCCCAAAGAAGGTCGCATTTACAACAACGTTTCTCCTGAAAGACGTCAAATTTTGGCCAATGACCTTGGAGATACTCCACCCATGGGGTGTAATAGTTGGAATCACTTTGGCTGCAACAATAATGAATCCATAATTCAAGCACCTGTTGATGTTATTCTTTCAACTAGTCTCGCTAAACTTAGATACAAGTA...

Protein

Download Protein FASTA

184 aa · LXL04_007061|LXL04_007061|OH1004|PROTEIN

MGEIIRMALILVAVMLMLVVDAAPKEGRIYNNVSPERRQILANDLGDTPPMGCNSWNHFGCNNNESIIQAPVDVILSTSLAKLRYKYVNIDDCWVESTSDQHSNFVEKLSTDPSGIKVLVAYVHKKVLKLGIYTNSGSLTCSNKIPSSLSYEEEDAKIFASWGIDYLKQCFKTCPTRPITWNWP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007061`
TK1151 ID	TkA03G107880
OH-1004 ID	LXL04_007061
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007061

Location Chr02:34931289-34931843 (-)

Description Similar to AGAL1: Alpha-galactosidase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08380`	May regulate leaf (and possibly other organ) development by functioning in cell wall loosening and cell wall expansion.	No verified direct reference in this release
`At5g08370`	May regulate leaf (and possibly other organ) development by functioning in cell wall loosening and cell wall expansion.	An alpha-galactosidase with an essential function during leaf development.2007 · DOI: 10.1007/s00425-006-0350-9

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0493600`	Hydrolyzes melibiose, raffinose and stachyose in the following decreasing order of reactivity: raffinose, melibiose, stachyose.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007061 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009620 response to fungus Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0051682 galactomannan catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0004557 alpha-galactosidase activity Molecular Function

GO:0052692 raffinose alpha-galactosidase activity Molecular Function

KEGG gene cross-reference

ath:AT5G08370

ath:AT5G08380

dosa:Os10g0493600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.651

Rank 1 · LXL04_007061 · OH-1004

Lysosome / Vacuole0.101

Rank 2 · LXL04_007061 · OH-1004

Cytoplasm0.091

Rank 3 · LXL04_007061 · OH-1004

Endoplasmic reticulum0.082

Rank 4 · LXL04_007061 · OH-1004

Cell membrane0.030

Rank 5 · LXL04_007061 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16499.12Melibiase_248-169 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007061	`PF16499.12`	Melibiase_2	48	169	4e-27	96.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FT97`	Arabidopsis thaliana	Alpha-galactosidase 1	50.898%	Swiss-Prot	strong database homology
`Q8RX86`	Arabidopsis thaliana	Alpha-galactosidase 2	55.639%	Swiss-Prot	strong database homology
`Q9FXT4`	Oryza sativa subsp. japonica	Alpha-galactosidase	60.938%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card