LXL04_007045 | RubberDandelionOmics

Gene overview

LXL04_007045

Reference: OH-1004 Chr: Chr02 Coordinates: 34311512-34313785 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

975 bp · LXL04_007045|LXL04_007045|OH1004|cDNA

ATGGGTACTTGGCAATTTTCTTCGTGGAATTTGAGATCCCTTTTCAGTTCTAGGAATTCCGCCGAAACCTTTCAGGATGCATCAACCAGGAAGCAAGATATTTCATCTGTTACAAACCCGTTTTATCATCTTTACTCTCCTTTAATAAATGACAAAAAGACAGAGAGTAGAATGAGAAATGGACAGCTGGCAATCCATACCTTGAGGTCTCATGGGATGGTGGTGGCAAAAACTCACATGTATGATTGGTTGATTCTTGT...

CDS

Download CDS FASTA

975 bp · LXL04_007045|LXL04_007045|OH1004|CDS

ATGGGTACTTGGCAATTTTCTTCGTGGAATTTGAGATCCCTTTTCAGTTCTAGGAATTCCGCCGAAACCTTTCAGGATGCATCAACCAGGAAGCAAGATATTTCATCTGTTACAAACCCGTTTTATCATCTTTACTCTCCTTTAATAAATGACAAAAAGACAGAGAGTAGAATGAGAAATGGACAGCTGGCAATCCATACCTTGAGGTCTCATGGGATGGTGGTGGCAAAAACTCACATGTATGATTGGTTGATTCTTGT...

Protein

Download Protein FASTA

324 aa · LXL04_007045|LXL04_007045|OH1004|PROTEIN

MGTWQFSSWNLRSLFSSRNSAETFQDASTRKQDISSVTNPFYHLYSPLINDKKTESRMRNGQLAIHTLRSHGMVVAKTHMYDWLILVVLAVIMTVLSCIHPFYRHVGKDMMTDLKYPLQDNTVPIWAVPIYAILFPIGVFLAFYFFRRDVYDLHHATLGILFSVLITGVITDAIKDAVGRPRPDFFWRCFPDGKDVRFHFRHFPQFYDQLGNVICHGDTKVIREGHKSFPSGHTSWSFSGLGFLSLYLCGKIRVFDCKGH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007045`
TK1151 ID	TkA03G105510
OH-1004 ID	LXL04_007045
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.600
Protein coverage (%)	TK1151 100.000 / OH-1004 68.210 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007045

Location Chr02:34311512-34313785 (-)

Description Similar to LPP3: Putative lipid phosphate phosphatase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02600`	Putative lipid phosphate phosphatase 3, chloroplastic.	No verified direct reference in this release
`At2g01180`	Plays a general role in cellular responses to stress, may be by attenuating the signal produced by phospholipases.	Lipid phosphate phosphatases in Arabidopsis. Regulation of the AtLPP1 gene in response to stress.2001 · DOI: 10.1074/jbc.m009726200
`At1g15080`	May play a general 'housekeeping role' in lipid metabolism.	Lipid phosphate phosphatases in Arabidopsis. Regulation of the AtLPP1 gene in response to stress.2001 · DOI: 10.1074/jbc.m009726200 An important role of phosphatidic acid in ABA signaling during germination in Arabidopsis thaliana.2005 · DOI: 10.1111/j.1365-313x.2005.02431.x Arabidopsis thaliana lipid phosphate phosphatase 2 is involved in abscisic acid signalling in leaves.2011 · DOI: 10.1016/j.plaphy.2011.01.010
`At3g18220`	Probable lipid phosphate phosphatase 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007045 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006644 phospholipid metabolic process Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010224 response to UV-B Biological Process

GO:0046839 phospholipid dephosphorylation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0000810 diacylglycerol diphosphate phosphatase activity Molecular Function

GO:0003993 acid phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G15080

ath:AT2G01180

ath:AT3G02600

ath:AT3G18220

xla:443950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.278

Rank 1 · LXL04_007045 · OH-1004

Golgi apparatus0.238

Rank 2 · LXL04_007045 · OH-1004

Cell membrane0.230

Rank 3 · LXL04_007045 · OH-1004

Endoplasmic reticulum0.217

Rank 4 · LXL04_007045 · OH-1004

Cytoplasm0.208

Rank 5 · LXL04_007045 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01569.28PAP2158-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007045	`PF01569.28`	PAP2	158	311	2e-30	105.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LFD1`	Arabidopsis thaliana	Putative lipid phosphate phosphatase 3, chloroplastic	67.905%	Swiss-Prot	strong database homology
`Q9ZU49`	Arabidopsis thaliana	Lipid phosphate phosphatase 1	63.704%	Swiss-Prot	strong database homology
`Q9XI60`	Arabidopsis thaliana	Lipid phosphate phosphatase 2	68.321%	Swiss-Prot	strong database homology
`Q0WNG6`	Arabidopsis thaliana	Probable lipid phosphate phosphatase 4	59.774%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card