LXL04_006982 | RubberDandelionOmics

Gene overview

LXL04_006982

Reference: OH-1004 Chr: Chr02 Coordinates: 32860711-32870743 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3381 bp · LXL04_006982|LXL04_006982|OH1004|cDNA

ATGGAAAAAGCTGGAGGTTTGGAATTAGAAACAACAGGTGGCCTTCAGTCTACTTATATAAAGAGTGTGACACCAAATGCTATTGAACATATGCCAGAGGAGTTGATACAGCTCATCCAATACCACTTGCCAGTAAACAAAGGGGCCCGCACGGCCGTGTTGTCCAAGTCATGGCGACACGCTTGGTCTACCAACCCTAACCTCAGGTTCCATTTAAGTGGAGAAAAGAGCTTGAAGTTTGTGGACCGCACTCTAACAAG...

CDS

Download CDS FASTA

3381 bp · LXL04_006982|LXL04_006982|OH1004|CDS

ATGGAAAAAGCTGGAGGTTTGGAATTAGAAACAACAGGTGGCCTTCAGTCTACTTATATAAAGAGTGTGACACCAAATGCTATTGAACATATGCCAGAGGAGTTGATACAGCTCATCCAATACCACTTGCCAGTAAACAAAGGGGCCCGCACGGCCGTGTTGTCCAAGTCATGGCGACACGCTTGGTCTACCAACCCTAACCTCAGGTTCCATTTAAGTGGAGAAAAGAGCTTGAAGTTTGTGGACCGCACTCTAACAAG...

Protein

Download Protein FASTA

1126 aa · LXL04_006982|LXL04_006982|OH1004|PROTEIN

MEKAGGLELETTGGLQSTYIKSVTPNAIEHMPEELIQLIQYHLPVNKGARTAVLSKSWRHAWSTNPNLRFHLSGEKSLKFVDRTLTRYLRENLLIEKVKLEIDITNWKFSPAEKLIWLIATKTCLKEFSLSVMCSYSSYGNNFTLSDDLLLGENLTKIRVQGAGKGEVNCVKMMTSLHPVIKCVSLQELDLVGVRISEAALNHIFSSCTLLVKIRLRKIVLCSKKFKNIKVKNLPRLYELHVGFYSWYSYPDLEISDVPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006982`
TK1151 ID	TkA02G562600
OH-1004 ID	LXL04_006982
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.100
Protein coverage (%)	TK1151 92.054 / OH-1004 39.520 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006982

Location Chr02:32860711-32870743 (-)

Description Similar to GC5: Golgin candidate 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79830`	Golgi matrix protein playing a role in tethering of vesicles to Golgi membranes and in maintaining the overall structure of the Golgi apparatus.	No verified direct reference in this release
`At3g03360`	F-box/LRR-repeat protein At3g03360.	No verified direct reference in this release
`At3g03040`	F-box protein At3g03040.	No verified direct reference in this release
`At3g59210`	F-box/LRR-repeat protein At3g59210.	No verified direct reference in this release
`At2g39415`	Putative F-box protein At2g39415.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006982 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G79830

ath:AT2G39415

ath:AT3G03040

ath:AT3G59210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.502

Rank 1 · LXL04_006982 · OH-1004

Cytoplasm0.476

Rank 2 · LXL04_006982 · OH-1004

Cell membrane0.124

Rank 3 · LXL04_006982 · OH-1004

Endoplasmic reticulum0.071

Rank 4 · LXL04_006982 · OH-1004

Mitochondrion0.031

Rank 5 · LXL04_006982 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622.2LRR_At1g61320_AtMIF1762-937 aa

PF24758.2LRR_At5g56370795-910 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006982	`PF23622.2`	LRR_At1g61320_AtMIF1	762	937	4.5e-10	40.2
LXL04_006982	`PF24758.2`	LRR_At5g56370	795	910	2.2e-17	64.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WVL7`	Arabidopsis thaliana	Golgin candidate 5	37.975%	Swiss-Prot	weak database homology
`Q84W80`	Arabidopsis thaliana	F-box/LRR-repeat protein At3g03360	26.531%	Swiss-Prot	weak database homology
`Q9LDJ9`	Arabidopsis thaliana	F-box protein At3g03040	28.295%	Swiss-Prot	weak database homology
`Q8GW80`	Arabidopsis thaliana	F-box/LRR-repeat protein At3g59210	27.170%	Swiss-Prot	weak database homology
`Q3EBJ8`	Arabidopsis thaliana	Putative F-box protein At2g39415	38.806%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card