LXL04_006820 | RubberDandelionOmics

Gene overview

LXL04_006820

Reference: OH-1004 Chr: Chr02 Coordinates: 26456725-26457420 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

696 bp · LXL04_006820|LXL04_006820|OH1004|cDNA

ATGGAGATGATGATGGAGCTTGACAAGCTTCCCGACCCATTTTCCCTACCTTCCCAAGACCATTCTTATTCATCCATCATGGATTTAAACTTCTCCGGCGGAAACTCCACCATGAACCACCGTGCACCACTGCCGCATCACATAAATTACCCTACCCATGATCCGATGGGACTTCCGGCGCCACCGTTTACAGTTTCCCATGATCATTATCCACGTGCGAGCTGGCTGCAACAGAAGCCGGACTCGGTGGAGGCGATGAG...

CDS

Download CDS FASTA

696 bp · LXL04_006820|LXL04_006820|OH1004|CDS

ATGGAGATGATGATGGAGCTTGACAAGCTTCCCGACCCATTTTCCCTACCTTCCCAAGACCATTCTTATTCATCCATCATGGATTTAAACTTCTCCGGCGGAAACTCCACCATGAACCACCGTGCACCACTGCCGCATCACATAAATTACCCTACCCATGATCCGATGGGACTTCCGGCGCCACCGTTTACAGTTTCCCATGATCATTATCCACGTGCGAGCTGGCTGCAACAGAAGCCGGACTCGGTGGAGGCGATGAG...

Protein

Download Protein FASTA

231 aa · LXL04_006820|LXL04_006820|OH1004|PROTEIN

MEMMMELDKLPDPFSLPSQDHSYSSIMDLNFSGGNSTMNHRAPLPHHINYPTHDPMGLPAPPFTVSHDHYPRASWLQQKPDSVEAMREMIFRMAALQPIQIDPESVKPPKRRNVKISKDPQSVAARHRRERISERIRILQRLVPGGTKMDTASMLDEAVHYMKFLKKQVQSMEQAAVGGGGGNIPTAGINNVVGISPTTTMSHHGANNYPNVIRACGEPSAYMVGSMELLK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006820`
TK1151 ID	TkA03G076600
OH-1004 ID	LXL04_006820
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006820

Location Chr02:26456725-26457420 (+)

Description Similar to HEC2: Transcription factor HEC2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50330`	Required for the female reproductive tract development and fertility.	The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.011510
`At5g67060`	Required for the female reproductive tract development and fertility.	The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.011510
`At3g21330`	Transcription factor bHLH87.	No verified direct reference in this release
`At4g00120`	Transcription regulator required for seed dispersal.	No verified direct reference in this release
`At5g09750`	Required for the female reproductive tract development and fertility.	The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.011510

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006820 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010500 transmitting tissue development Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048462 carpel formation Biological Process

GO:0048467 gynoecium development Biological Process

GO:0080126 ovary septum development Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G21330

ath:AT3G50330

ath:AT4G00120

ath:AT5G09750

ath:AT5G67060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.978

Rank 1 · LXL04_006820 · OH-1004

Cytoplasm0.089

Rank 2 · LXL04_006820 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_006820 · OH-1004

Endoplasmic reticulum0.019

Rank 4 · LXL04_006820 · OH-1004

Plastid0.011

Rank 5 · LXL04_006820 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010.32HLH125-166 aa

PF23173.3bHLH_SAC51127-170 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006820	`PF00010.32`	HLH	125	166	1.7e-07	31.6
LXL04_006820	`PF23173.3`	bHLH_SAC51	127	170	2.2e-12	47.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SND4`	Arabidopsis thaliana	Transcription factor HEC2	56.633%	Swiss-Prot	strong database homology
`Q9FHA7`	Arabidopsis thaliana	Transcription factor HEC1	88.172%	Swiss-Prot	weak database homology
`Q8S3D2`	Arabidopsis thaliana	Transcription factor bHLH87	64.516%	Swiss-Prot	weak database homology
`O81313`	Arabidopsis thaliana	Transcription factor IND	46.584%	Swiss-Prot	moderate database homology
`Q9LXD8`	Arabidopsis thaliana	Transcription factor HEC3	76.744%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card