LXL04_006817 | RubberDandelionOmics

Gene overview

LXL04_006817

Reference: OH-1004 Chr: Chr02 Coordinates: 26118509-26119012 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

453 bp · LXL04_006817|LXL04_006817|OH1004|cDNA

ATGGCTTTGGCTCGCCGGAGTTCCAATCTCCTCAAGCCTCTCTCCACcgcctcctcctcctcctccttcCTCCACCGCCGCCCTTTCTCCACTGATGACTCCACTACCATCACCATCGAGACCAGCGTCCCTTTCACCGGCCACAACTGCGAGCCTCCCTCGAGATCCATCGATACTAGTCCCAAAGAACTCATGACTTTCTTCACCGATATGGCACTTATGCACCGTATGGAGATCGCCGCCGACTCTCTCTACAAATC...

CDS

Download CDS FASTA

453 bp · LXL04_006817|LXL04_006817|OH1004|CDS

ATGGCTTTGGCTCGCCGGAGTTCCAATCTCCTCAAGCCTCTCTCCACCGCCTCCTCCTCCTCCTCCTTCCTCCACCGCCGCCCTTTCTCCACTGATGACTCCACTACCATCACCATCGAGACCAGCGTCCCTTTCACCGGCCACAACTGCGAGCCTCCCTCGAGATCCATCGATACTAGTCCCAAAGAACTCATGACTTTCTTCACCGATATGGCACTTATGCACCGTATGGAGATCGCCGCCGACTCTCTCTACAAATC...

Protein

Download Protein FASTA

150 aa · LXL04_006817|LXL04_006817|OH1004|PROTEIN

MALARRSSNLLKPLSTASSSSSFLHRRPFSTDDSTTITIETSVPFTGHNCEPPSRSIDTSPKELMTFFTDMALMHRMEIAADSLYKSKLIRGFCHLYDGQEAVSIGVEAAITKKDCIITAYRDHCIFLGRNRVYAVQIGLFGPVKIEFVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006817`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006817

Location Chr02:26118509-26119012 (-)

Description Similar to Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g59900`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release
`At1g24180`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0739600`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006817 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006086 pyruvate decarboxylation to acetyl-CoA Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0045254 pyruvate dehydrogenase complex Cellular Component

GO:0004739 pyruvate dehydrogenase (acetyl-transferring) activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0050897 cobalt ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G24180

ath:AT1G59900

dosa:Os02g0739600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.675

Rank 1 · LXL04_006817 · OH-1004

Plastid0.327

Rank 2 · LXL04_006817 · OH-1004

Cytoplasm0.043

Rank 3 · LXL04_006817 · OH-1004

Nucleus0.035

Rank 4 · LXL04_006817 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_006817 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00676.26E1_dh70-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006817	`PF00676.26`	E1_dh	70	131	2e-16	60.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P52901`	Arabidopsis thaliana	Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial	67.910%	Swiss-Prot	strong database homology
`Q8H1Y0`	Arabidopsis thaliana	Pyruvate dehydrogenase E1 component subunit alpha-2, mitochondrial	67.164%	Swiss-Prot	strong database homology
`Q6Z5N4`	Oryza sativa subsp. japonica	Pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial	60.656%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card