LXL04_006789 | RubberDandelionOmics

Gene overview

LXL04_006789

Reference: OH-1004 Chr: Chr02 Coordinates: 25166894-25175321 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3342 bp · LXL04_006789|LXL04_006789|OH1004|cDNA

ATGGATAACTCACCGGAGAATTGCAACGTGAAGGTCGCGTTGCATATTCGTCCTCTCAGCCGCCAGGAGCGGCAAAACGGCGGCAAAGAATGTTTGGACGTCGTTCCGGGGACGGCTCAGGTGTTAATGGATACACATTCGTTTATATTTGATCATATATATGGAGGAGGAGGTTCTCCATCAGTCAATATGTTTGAAGAGTGTGCAATTCCTCTCTTAGATGCTTTGTTTCAAGGATACAATGGTACAGTTATCGCATA...

CDS

Download CDS FASTA

3342 bp · LXL04_006789|LXL04_006789|OH1004|CDS

ATGGATAACTCACCGGAGAATTGCAACGTGAAGGTCGCGTTGCATATTCGTCCTCTCAGCCGCCAGGAGCGGCAAAACGGCGGCAAAGAATGTTTGGACGTCGTTCCGGGGACGGCTCAGGTGTTAATGGATACACATTCGTTTATATTTGATCATATATATGGAGGAGGAGGTTCTCCATCAGTCAATATGTTTGAAGAGTGTGCAATTCCTCTCTTAGATGCTTTGTTTCAAGGATACAATGGTACAGTTATCGCATA...

Protein

Download Protein FASTA

1113 aa · LXL04_006789|LXL04_006789|OH1004|PROTEIN

MDNSPENCNVKVALHIRPLSRQERQNGGKECLDVVPGTAQVLMDTHSFIFDHIYGGGGSPSVNMFEECAIPLLDALFQGYNGTVIAYGQTGSGKTYTMGTNPKESSHRGLMFQIMQTIFNKIETLKHETEFQLHVSFIEILNEEVRDLLDSAVLDRAESTDGNPDNPVPCKPPVQVRKATDGAVSLSGSTEVCVTTQKEMIGCLEQGCLKRSVASTNMNSQSSRSHAIYTIILEQKDKSKGEENGNDYMGEEYRCAKLHL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006789`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006789

Location Chr02:25166894-25175321 (-)

Description Similar to KIN4A: Kinesin-like protein KIN-4A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47820`	Kinesin-like motor protein involved in the control of the oriented deposition of cellulose microfibrils.	A kinesin-like protein is essential for oriented deposition of cellulose microfibrils and cell wall strength.2002 · DOI: 10.1105/tpc.005801 Single molecule analysis of the Arabidopsis FRA1 kinesin shows that it is a functional motor protein with unusually high processivity.2011 · DOI: 10.1093/mp/ssr077 Kinesin-4 Functions in Vesicular Transport on Cortical Microtubules and Regulates Cell Wall Mechanics during Cell Elongation in Plants.2015 · DOI: 10.1016/j.molp.2015.01.004
`At3g50240`	Kinesin-like motor protein involved in the control of the oriented deposition of cellulose microfibrils.	No verified direct reference in this release
`At5g60930`	Kinesin-like motor protein involved in the control of the oriented deposition of cellulose microfibrils.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0114500`	Microtubule-dependent motor protein involved in the control of the oriented deposition of cellulose microfibrils.	Mutation of rice BC12/GDD1, which encodes a kinesin-like protein that binds to a GA biosynthesis gene promoter, leads to dwarfism with impaired cell elongation.2011 · DOI: 10.1105/tpc.110.081901

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006789 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007018 microtubule-based movement Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0030705 cytoskeleton-dependent intracellular transport Biological Process

GO:0051231 spindle elongation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005875 microtubule associated complex Cellular Component

GO:0055028 cortical microtubule Cellular Component

GO:0003777 microtubule motor activity Molecular Function

KEGG gene cross-reference

ath:AT3G50240

ath:AT5G47820

ghi:107917911

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.695

Rank 1 · LXL04_006789 · OH-1004

Nucleus0.211

Rank 2 · LXL04_006789 · OH-1004

Cell membrane0.140

Rank 3 · LXL04_006789 · OH-1004

Golgi apparatus0.082

Rank 4 · LXL04_006789 · OH-1004

Mitochondrion0.052

Rank 5 · LXL04_006789 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00225.30Kinesin16-361 aa

PF16796.12Microtub_bd40-149 aa

PF25764.2KIF21A_4th490-669 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006789	`PF00225.30`	Kinesin	16	361	2.4e-101	339.7
LXL04_006789	`PF16796.12`	Microtub_bd	40	149	1.8e-18	67.7
LXL04_006789	`PF25764.2`	KIF21A_4th	490	669	1.3e-27	97.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GS71`	Arabidopsis thaliana	Kinesin-like protein KIN-4A	50.384%	Swiss-Prot	strong database homology
`Q94LW7`	Arabidopsis thaliana	Kinesin-like protein KIN-4B	50.111%	Swiss-Prot	strong database homology
`F4K0J3`	Arabidopsis thaliana	Kinesin-like protein KIN-4C	43.362%	Swiss-Prot	moderate database homology
`Q6YUL8`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-4A	50.497%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card