LXL04_006788 | RubberDandelionOmics

Gene overview

LXL04_006788

Reference: OH-1004 Chr: Chr02 Coordinates: 25162921-25165459 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2058 bp · LXL04_006788|LXL04_006788|OH1004|cDNA

ATGTGCGCCCTACCTAAACCCttccaccaccgccaccgccaccgccaccaccaccgccaccgccagCACTATCTATTGTCTTTCATTATCCTCCTCACCGCCACCGCCTCCGCCGTGGACCCGAAACCGGTTGAAGCACTAGTGCCCTCCGACGCCGTCGCGCTACTCAAATTCAAGCTACAAGCTGACATTGGAAACAAGCTCCTCTATGATCTTAACGAGCGGTTCGATTATTGTCAATGGCAAGGAGCGAAATGTGT...

CDS

Download CDS FASTA

2058 bp · LXL04_006788|LXL04_006788|OH1004|CDS

ATGTGCGCCCTACCTAAACCCTTCCACCACCGCCACCGCCACCGCCACCACCACCGCCACCGCCAGCACTATCTATTGTCTTTCATTATCCTCCTCACCGCCACCGCCTCCGCCGTGGACCCGAAACCGGTTGAAGCACTAGTGCCCTCCGACGCCGTCGCGCTACTCAAATTCAAGCTACAAGCTGACATTGGAAACAAGCTCCTCTATGATCTTAACGAGCGGTTCGATTATTGTCAATGGCAAGGAGCGAAATGTGT...

Protein

Download Protein FASTA

685 aa · LXL04_006788|LXL04_006788|OH1004|PROTEIN

MCALPKPFHHRHRHRHHHRHRQHYLLSFIILLTATASAVDPKPVEALVPSDAVALLKFKLQADIGNKLLYDLNERFDYCQWQGAKCVQGRVVRFVLQGCGLSGVFADNTLTRLDQLRVLSLRNNSLSGAIPDLSALTNLKTLFLDHNAFSGKFPLPLVALHRLRSLDLARNNLSGPLPIELNSLDRLTYLRLEWNRFNGSLPPLNITALEVFNVSGNNLTGSVPVTPALSRFDISSYLLNPGLCGKILNKICSSNAPFFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006788`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006788

Location Chr02:25162921-25165459 (+)

Description Similar to At5g67200: Probable inactive receptor kinase At5g67200

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67200`	Probable inactive receptor kinase At5g67200.	No verified direct reference in this release
`At1g60630`	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630.	No verified direct reference in this release
`At1g68400`	Probable leucine-rich repeat receptor-like protein kinase At1g68400.	No verified direct reference in this release
`At1g48480`	Probable inactive receptor kinase At1g48480.	No verified direct reference in this release
`At3g17840`	Probable inactive receptor kinase RLK902.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006788 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0042742 defense response to bacterium Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G48480

ath:AT1G60630

ath:AT1G68400

ath:AT3G17840

ath:AT5G67200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.868

Rank 1 · LXL04_006788 · OH-1004

Endoplasmic reticulum0.078

Rank 2 · LXL04_006788 · OH-1004

Cytoplasm0.076

Rank 3 · LXL04_006788 · OH-1004

Nucleus0.067

Rank 4 · LXL04_006788 · OH-1004

Lysosome / Vacuole0.019

Rank 5 · LXL04_006788 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12799.14LRR_4115-147 aa

PF13855.13LRR_8137-197 aa

PF00069.32Pkinase410-609 aa

PF07714.24PK_Tyr_Ser-Thr410-662 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006788	`PF12799.14`	LRR_4	115	147	2.7e-11	44.0
LXL04_006788	`PF13855.13`	LRR_8	137	197	3.9e-08	33.6
LXL04_006788	`PF00069.32`	Pkinase	410	609	8.7e-30	104.7
LXL04_006788	`PF07714.24`	PK_Tyr_Ser-Thr	410	662	3.4e-29	102.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y06`	Arabidopsis thaliana	Probable inactive receptor kinase At5g67200	57.805%	Swiss-Prot	strong database homology
`Q84MA9`	Arabidopsis thaliana	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630	44.076%	Swiss-Prot	moderate database homology
`Q9M9C5`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At1g68400	38.213%	Swiss-Prot	moderate database homology
`Q9LP77`	Arabidopsis thaliana	Probable inactive receptor kinase At1g48480	33.590%	Swiss-Prot	moderate database homology
`Q9LVI6`	Arabidopsis thaliana	Probable inactive receptor kinase RLK902	33.078%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card