LXL04_006784 | RubberDandelionOmics

Gene overview

LXL04_006784

Reference: OH-1004 Chr: Chr02 Coordinates: 25138095-25139232 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

957 bp · LXL04_006784|LXL04_006784|OH1004|cDNA

ATGGCCGTAGATCTAATCATGGGCTTCAGAACCACTGCCTCCGACGAAACCAACGCCGTCCAAGAGGCTGCTTCCGGCCTTGAAAGCGTCCAGAAGCTTATCCGTCTGCTTTCTCAATCGCAGTCTCAACAACAACAGTCGCCGGCCGATTATAAAGCCGTCGCCGATGTCGCGGTAACGAAGTTCAAACGGGTTATTTCTTTGTTGGGAAGACCCAGTCGGGAACTAACGGGTCATGCTCGTTTCCGGCGAGCTCCTGT...

CDS

Download CDS FASTA

957 bp · LXL04_006784|LXL04_006784|OH1004|CDS

ATGGCCGTAGATCTAATCATGGGCTTCAGAACCACTGCCTCCGACGAAACCAACGCCGTCCAAGAGGCTGCTTCCGGCCTTGAAAGCGTCCAGAAGCTTATCCGTCTGCTTTCTCAATCGCAGTCTCAACAACAACAGTCGCCGGCCGATTATAAAGCCGTCGCCGATGTCGCGGTAACGAAGTTCAAACGGGTTATTTCTTTGTTGGGAAGACCCAGTCGGGAACTAACGGGTCATGCTCGTTTCCGGCGAGCTCCTGT...

Protein

Download Protein FASTA

318 aa · LXL04_006784|LXL04_006784|OH1004|PROTEIN

MAVDLIMGFRTTASDETNAVQEAASGLESVQKLIRLLSQSQSQQQQSPADYKAVADVAVTKFKRVISLLGRPSRELTGHARFRRAPVNHGGYRDKTIMKDHEQEDVGSDEGETKVYCPTPIQQVPFVPPPPPAAPATSNQPVVFQRKDSLPKTISFSYSPAVSRASSFISSLTGDSDGKQLSAGGKPPLCSSSCLKRKCSSSENGASGKCSGSSTGRCHCSKRRKLRMKRVVRVKAISMKLADIPPDDYSWRKYGQKPIK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006784`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006784

Location Chr02:25138095-25139232 (+)

Description Similar to WRKY7: Probable WRKY transcription factor 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24240`	Transcription factor.	No verified direct reference in this release
`At4g31550`	Transcription factor.	Transcription factors WRKY70 and WRKY11 served as regulators in rhizobacterium Bacillus cereus AR156-induced systemic resistance to Pseudomonas syringae pv. tomato DC3000 in Arabidopsis.2016 · DOI: 10.1093/jxb/erv445
`At2g23320`	Transcription factor.	No verified direct reference in this release
`At2g24570`	Transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0287400`	Transcription factor.	Interactions of two abscisic-acid induced WRKY genes in repressing gibberellin signaling in aleurone cells.2006 · DOI: 10.1111/j.1365-313x.2006.02694.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006784 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G23320

ath:AT2G24570

ath:AT4G24240

ath:AT4G31550

dosa:Os04g0287400

osa:4335388

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.930

Rank 1 · LXL04_006784 · OH-1004

Cytoplasm0.184

Rank 2 · LXL04_006784 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_006784 · OH-1004

Mitochondrion0.024

Rank 4 · LXL04_006784 · OH-1004

Endoplasmic reticulum0.012

Rank 5 · LXL04_006784 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10533.15Plant_zn_clust196-243 aa

PF03106.22WRKY247-303 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006784	`PF10533.15`	Plant_zn_clust	196	243	2.5e-17	63.4
LXL04_006784	`PF03106.22`	WRKY	247	303	8.8e-27	93.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STX0`	Arabidopsis thaliana	Probable WRKY transcription factor 7	47.353%	Swiss-Prot	moderate database homology
`Q9SV15`	Arabidopsis thaliana	Probable WRKY transcription factor 11	48.512%	Swiss-Prot	moderate database homology
`O22176`	Arabidopsis thaliana	Probable WRKY transcription factor 15	45.531%	Swiss-Prot	moderate database homology
`Q9SJA8`	Arabidopsis thaliana	Probable WRKY transcription factor 17	42.982%	Swiss-Prot	moderate database homology
`Q0JEE2`	Oryza sativa subsp. japonica	WRKY transcription factor WRKY51	43.478%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card