LXL04_006738 | RubberDandelionOmics

Gene overview

LXL04_006738

Reference: OH-1004 Chr: Chr02 Coordinates: 23762463-23766486 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1200 bp · LXL04_006738|LXL04_006738|OH1004|cDNA

atGACACTTTCCGAGGGTCTCACCTCACATGCCACATGCCCAATTTCACCGACGCTCTCCCATTATAAATACTACTCTCCTTCGATCACCACCTTCTGTCACCATTCACCAACTTGGAAGAACATGAAGCTTCAATCATCAGCAGCTCTTCTACTCCTCTCTCTTCTCTTCACCTCATCATTCATCGAATCCGCCATCACCGCCTCTCCAACCGGCGCCCCTGGTCCCTCCCCAAGTGGATCATTAGGATGCGATAAGAA...

CDS

Download CDS FASTA

1200 bp · LXL04_006738|LXL04_006738|OH1004|CDS

ATGACACTTTCCGAGGGTCTCACCTCACATGCCACATGCCCAATTTCACCGACGCTCTCCCATTATAAATACTACTCTCCTTCGATCACCACCTTCTGTCACCATTCACCAACTTGGAAGAACATGAAGCTTCAATCATCAGCAGCTCTTCTACTCCTCTCTCTTCTCTTCACCTCATCATTCATCGAATCCGCCATCACCGCCTCTCCAACCGGCGCCCCTGGTCCCTCCCCAAGTGGATCATTAGGATGCGATAAGAA...

Protein

Download Protein FASTA

399 aa · LXL04_006738|LXL04_006738|OH1004|PROTEIN

MTLSEGLTSHATCPISPTLSHYKYYSPSITTFCHHSPTWKNMKLQSSAALLLLSLLFTSSFIESAITASPTGAPGPSPSGSLGCDKKCAVRCSKTAWREMCLQLCGICCGKCNGCVPSGPRADKAECPCYRDMKNKKGKDKGIQLFNNKFSGSIPPTFSSCTVLQNLDFGNNSLVGEIPDSFGNCTKLYNVNLSLNSLTGSVPVSLSQSNSLMFLSLQFNNFLGVLPDSWGGGKNGDKSIVKSIRYLFRVKRIERKDYKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006738`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006738

Location Chr02:23762463-23766486 (+)

Description Similar to IMK2: Probably inactive leucine-rich repeat receptor-like protein kinase IMK2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51740`	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2.	No verified direct reference in this release
`At3g56100`	Can phosphorylate AGL24.	No verified direct reference in this release
`At5g59845`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release
`At2g39540`	Gibberellin-regulated protein that may function in hormonal controlled steps of development such as seed germination, flowering and seed maturation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006738 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G51740

ath:AT5G59845

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.303

Rank 1 · LXL04_006738 · OH-1004

Endoplasmic reticulum0.251

Rank 2 · LXL04_006738 · OH-1004

Cell membrane0.212

Rank 3 · LXL04_006738 · OH-1004

Cytoplasm0.151

Rank 4 · LXL04_006738 · OH-1004

Nucleus0.112

Rank 5 · LXL04_006738 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02704.20GASA84-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006738	`PF02704.20`	GASA	84	141	6.6e-16	58.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCT4`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2	48.000%	Swiss-Prot	weak database homology
`C0LGP9`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase IMK3	49.451%	Swiss-Prot	weak database homology
`Q8LFM2`	Arabidopsis thaliana	Gibberellin-regulated protein 10	50.000%	Swiss-Prot	weak database homology
`O80641`	Arabidopsis thaliana	Gibberellin-regulated protein 8	48.913%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card